DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and Rassf9

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_075248.1 Gene:Rassf9 / 65053 RGDID:621329 Length:435 Species:Rattus norvegicus


Alignment Length:413 Identity:92/413 - (22%)
Similarity:171/413 - (41%) Gaps:78/413 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PSQSESFSIWVNGEEHWISGADSSTTCADLICALISYQI----DQKHVLSKEEILAPQQFAIVQK 76
            |.:.| ..:||..||..:.|....||..|:|.||:....    :::.:|.|     ...:.||:|
  Rat    24 PEEKE-IVVWVCQEEKIVCGLTKRTTSIDVIQALLEEHEATFGEKRFLLGK-----ASDYCIVEK 82

  Fly    77 QRHYEEYLDSSARLLDVITS-----PH---AMPKEEYQLHLRHLATSSRKQVPTTDKDSGMGSPV 133
            .|..|..|....|:|.:..:     |:   .:.|.:..|.:....|:..|.|...:|...: ||.
  Rat    83 WRGSERALPPLTRILKLWKAWGDEQPNMQFVLVKTDAFLPVPLWRTAETKLVQNNEKPWEL-SPA 146

  Fly   134 DSSRSMRIRRRGKLLSTKTTDNINTKQSKRSRKQQQRNHHLTPNESLLTIILAQDETILQQMTML 198
            :..:::...::.:::.       .|.:.....:|...:|.....|.|:.:|::||.||.||:..:
  Rat   147 NYMKTLPPDKQKRIVR-------KTFRKLAKIRQDTGSHDRDNMECLVHLIISQDHTIHQQVQRM 204

  Fly   199 HEKDRQIFKIEEEKHQVRERELGKNYLLETYLKDLDEPQEKGEDLELFEEMTHIDVDRDFGIMSD 263
            .|.|.:|.|.|.:.|..|....|.:|:.|.||.    |:...|:.:|           ||....:
  Rat   205 KELDMEIEKCEAKIHLDRIGNDGADYVQEAYLM----PRSSEEEQKL-----------DFQSEDN 254

  Fly   264 STVQTALNSGTMQDDIRLYWLEKIHEVNKELQCEEELLLSLHSKVRRHQVKRAYQTKSEVL---- 324
            .|::. ||.|           |.:.::.::||....|:..|.:::.| :||.|....||.:    
  Rat   255 QTLED-LNDG-----------EGVSQLEEQLQYYRALIDKLSAEIER-EVKGAGTDGSEDMEGAA 306

  Fly   325 --------LQIERLDTELATQVA-DIHH----VERKLFTANEQLKAKLAVLECLSREFETT---- 372
                    |:..:.|.|.:.:.. .||.    ::|::..::..|:.|....|.|::||.:.    
  Rat   307 ACELENSDLESVKCDLEKSMKAGLKIHSHLSGIQREIKYSDSLLQMKAREYELLAKEFSSLHISS 371

  Fly   373 ---VSGGVQEGDVATGSNASAKV 392
               ..|....|..|..|:::.::
  Rat   372 KDGCQGKENRGKEAEASSSNGEI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
Rassf9NP_075248.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
RA 23..118 CDD:214612 25/99 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..423 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340735
Domainoid 1 1.000 73 1.000 Domainoid score I9032
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5189
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003658
OrthoInspector 1 1.000 - - otm46326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15286
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3544
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.