DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and Ppp1r13b

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_038968345.1 Gene:Ppp1r13b / 314465 RGDID:1304651 Length:1220 Species:Rattus norvegicus


Alignment Length:379 Identity:75/379 - (19%)
Similarity:134/379 - (35%) Gaps:126/379 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KEEYQLHLRHLATSSRKQVPTTDKDSGMGSPVDSSRSMRIRRR-GKLLSTKTTDN---------- 155
            :||.:..|||      :..||...:.|    ...|:..|.:|. ..:...|.|:|          
  Rat   170 REEVKFFLRH------EDSPTESSEQG----ARQSQEQRTQRNVMNVPGEKHTENGVGNPRVELT 224

  Fly   156 INTKQSKRSRKQQQRNHHLTPNESLLTIILAQDETILQQMTMLHEKDRQI-FKIEEEKHQVRERE 219
            ::..|...:|:|||                     |..|..||..|:::: |..::|:.|  ::.
  Rat   225 LSELQDMAARQQQQ---------------------IESQQQMLVAKEQRLHFLKQQERRQ--QQS 266

  Fly   220 LGKNYLLETYLKDLDEPQEKGEDLELFEEMTHIDVDRDFGIMSDSTVQTALNSGTMQDDIRLYWL 284
            :.:|..|:. ||:..|.||..                                           |
  Rat   267 ISENEKLQK-LKERVEAQENK-------------------------------------------L 287

  Fly   285 EKIHEVNKELQCEEELLLSLHSKVRRHQVKRAYQTKSEVLLQIERLDTELATQVADIHHVERKLF 349
            :||..:..::...:.:..:|.:::.|... ...:.|.||...|.|:| :|:.|:.|:...:...|
  Rat   288 KKIRAMRGQVDYSKIMNGNLSAEIERFSA-MFQEKKQEVQTAILRVD-QLSQQLEDLKKGKLNGF 350

  Fly   350 TA-NEQLKAKLAV-LECLSREFETTVSGGVQEGDVATGSNASAKVQQSQSDDLQHAGNWLHVVKR 412
            .: |.:|....|| |:.|.:|.:                 ...::.|.|:..||..       |.
  Rat   351 QSYNGRLTGPAAVELKRLYQELQ-----------------IRNQLNQEQNSKLQQQ-------KE 391

  Fly   413 LFAADHLNRRLTQQALSEKNLTDRLIPSKGISKQMFEVLRSPDP----STSNSV 462
            |     ||:|..:.|:.:|.:::......|...|:..|..:..|    |||..|
  Rat   392 L-----LNKRNMEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
Ppp1r13bXP_038968345.1 RA_ASPP1 101..183 CDD:340744 5/18 (28%)
SMC_prok_B <250..>426 CDD:274008 46/252 (18%)
PHA03247 <576..992 CDD:223021
Ank_2 1022..1108 CDD:403870
ANK repeat 1022..1048 CDD:293786
ANK repeat 1050..1081 CDD:293786
ANK repeat 1083..1112 CDD:293786
SH3 1152..1208 CDD:418401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.