DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and Rassf7

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001099787.1 Gene:Rassf7 / 293623 RGDID:1306244 Length:357 Species:Rattus norvegicus


Alignment Length:385 Identity:73/385 - (18%)
Similarity:119/385 - (30%) Gaps:145/385 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IWVNGEEHWISGADSSTTCADLICALISYQIDQKHVLSKEEILAPQQFAIVQKQRHYEEYLDSSA 88
            :||:|.:..:.|....|||.:::.||            .:.|....:|.:||:.|..|..|    
  Rat    12 VWVDGIQRVVCGVSEQTTCQEVVIAL------------AQAIGQTGRFVLVQRLREKERQL---- 60

  Fly    89 RLLDVITSPHAMPKEEYQLHLRHLATSSRKQVPTTDKDSGMGSPVDSSRS---------MRIRRR 144
                       :|:|                           .||.:..:         ..:||.
  Rat    61 -----------LPQE---------------------------CPVGAQATCGQFANDVQFVLRRT 87

  Fly   145 GKLLSTK-TTDN----------------INTKQSKRSRKQQQRN---HHLTPNESL--LTIILAQ 187
            |..||.: ::||                ......:..||....|   ..|.|:.|:  .|.::..
  Rat    88 GPSLSGRPSSDNCPPPERCPVRASLPPKAGATPGREPRKPLTFNLGCPRLVPSPSVPEPTALVGP 152

  Fly   188 DETILQQMTMLHEKDRQIFKIEEEKHQVRERELGKNYLLETYLKDLDEPQEKGEDLELFEEMTHI 252
            .......:..|           |.:.|....|||.....|..|:.....:::|:           
  Rat   153 IPDCFADLQSL-----------ELRIQRNTEELGHEAFWEQELQREQAREQEGQ----------- 195

  Fly   253 DVDRDFGIMSDSTVQTALNSGTMQDDIRLYWLEKIHEVNKELQCEEELLLSLHSKVRRHQVKRAY 317
                       :.:| ||::.|.:...||..|:.     :....|.||.|:          ..|.
  Rat   196 -----------ARLQ-ALSAATAEHAARLEALDA-----QACALEAELRLA----------AEAP 233

  Fly   318 QTKSEVLLQIERLDTELATQVADIHHVE---------RKLFTANEQLKAKLAVLECLSRE 368
            ...|......|||..:||.|  :.|.:|         :.|..|...|:|:...||.|:||
  Rat   234 GPPSATASAAERLRQDLAIQ--ERHSLEMQGTLALVSQALEAAEHALQAQAQELEELNRE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
Rassf7NP_001099787.1 RA_RASSF7 8..90 CDD:340552 23/131 (18%)
SbcC <157..>296 CDD:223496 39/186 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.