DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13875 and rassf10

DIOPT Version :9

Sequence 1:NP_001261185.1 Gene:CG13875 / 38024 FlyBaseID:FBgn0035104 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_002943807.1 Gene:rassf10 / 100492205 XenbaseID:XB-GENE-5915049 Length:434 Species:Xenopus tropicalis


Alignment Length:366 Identity:97/366 - (26%)
Similarity:157/366 - (42%) Gaps:58/366 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SIWVNGEEHWISGADSSTTCADLICALISYQIDQKHVLSKEEILAPQQFAIVQKQRHYEEYLDSS 87
            |:||..||..:||....|||||::..|:.....|:.......:..||.:.||:|.|.:|..|.:.
 Frog     9 SVWVCQEEKLVSGLTRHTTCADVVRILLEDHNQQQAEEGSMLLGPPQCYCIVEKWRGFERILPNK 73

  Fly    88 ARLLDVITSPHAMPKEEYQLHLRHLATSSRKQVPTTDKDSGMGSPVDSSRSMRIRRRGKLLSTKT 152
            .::|.:.|:     ..|.|.::|.:...|...:|.....|.....|.|..|...:|.....||..
 Frog    74 TKILRLWTA-----WGEEQDNVRFVLVRSEASLPNIGPRSAEAKVVLSKDSPCHQRTPSKASTGL 133

  Fly   153 TDNIN--------TKQSKRSRKQQQ----RNHHLTPNESLLTIILAQDETILQQMTMLHEKDRQI 205
            |....        .|.:|.:||:|:    .:..:...|:|:.::|:||.||.||:..:.|.||.|
 Frog   134 TQEKQRRVVRKAFRKLAKINRKRQEPLPKESSSVEKMETLVHLVLSQDHTIRQQIQRIMELDRDI 198

  Fly   206 FKIEEEKHQVRERELGKNYLLETYL------KDL--DEPQEKGEDLELFEE---------MTHID 253
            ...|...|..|.:..|.||:.||||      |||  |...::....|||.|         :....
 Frog   199 EMFEARIHFDRMKRHGVNYVQETYLVGAAPDKDLANDPTSDQAPQEELFAEYAQKCDQVLLLQEQ 263

  Fly   254 VDRDFGIMSDSTVQTALNSGTMQDDIRLYWLEKIHEVNKELQCEEELLLSLHSKVRRHQVKRAYQ 318
            :.:....|...|||       :|:::...|:|:..|             .|.:|.:...:.....
 Frog   264 IGQQEEAMEQITVQ-------IQEELNKRWMERRQE-------------ELSAKEQESCLPDQGG 308

  Fly   319 TKSEVLLQIERLDTELATQVADIHHVERKLFTANEQLKAKL 359
            .:|::||:.||:.|||:..:    ::..:|.|..|.:||.|
 Frog   309 DESQLLLEQERVKTELSASL----YIGLRLNTDLEAIKADL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13875NP_001261185.1 None
rassf10XP_002943807.1 RA_RASSF10 7..100 CDD:340549 28/95 (29%)
DUF5401 <122..>323 CDD:375164 55/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5778
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.