DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vdup1 and CSR2

DIOPT Version :10

Sequence 1:NP_612004.2 Gene:Vdup1 / 38023 FlyBaseID:FBgn0035103 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_015355.1 Gene:CSR2 / 856142 SGDID:S000006234 Length:1121 Species:Saccharomyces cerevisiae


Alignment Length:60 Identity:18/60 - (30%)
Similarity:25/60 - (41%) Gaps:4/60 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 YVP--GENILVTAFISNYSNVSIKRTKASLTETIEYLARGKVVQTEKRELAVLVRGKIRP 241
            |||  ||..:.........::|:||.:.|..|.|.|  |.|..|.:..:|..|......|
Yeast   652 YVPLNGEIPITIKVAPLVKSLSVKRIRVSCREKISY--RSKDYQYDFDQLDPLASDPCNP 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vdup1NP_612004.2 Arrestin_N 8..145 CDD:451447
Arrestin_C 171..299 CDD:214976 18/60 (30%)
CSR2NP_015355.1 Arrestin_C 638..>737 CDD:214976 18/60 (30%)
Arrestin_C <828..926 CDD:214976
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.