powered by:
Protein Alignment Dic61B and dnai1.1
DIOPT Version :9
Sequence 1: | NP_728477.1 |
Gene: | Dic61B / 38020 |
FlyBaseID: | FBgn0263988 |
Length: | 764 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021324725.1 |
Gene: | dnai1.1 / 570363 |
ZFINID: | ZDB-GENE-040910-7 |
Length: | 105 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 13/67 - (19%) |
Similarity: | 31/67 - (46%) |
Gaps: | 7/67 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 669 NVWDFRRNLLRPMSKHKMDSSFN--TVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDEL 731
:|:|...|....:.:.::.|:.. |...|:.....:::||:||..: .:..||:.:.:..
Zfish 20 HVFDLSINRFEALCQQRVVSTKRHLTCIEFNPVHPIIIVGNDRGRVI-----SLKLSPNLRKNPK 79
Fly 732 EK 733
|:
Zfish 80 EE 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006125 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.