DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic61B and dnai1.1

DIOPT Version :9

Sequence 1:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_021324725.1 Gene:dnai1.1 / 570363 ZFINID:ZDB-GENE-040910-7 Length:105 Species:Danio rerio


Alignment Length:67 Identity:13/67 - (19%)
Similarity:31/67 - (46%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 NVWDFRRNLLRPMSKHKMDSSFN--TVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDEL 731
            :|:|...|....:.:.::.|:..  |...|:.....:::||:||..:     .:..||:.:.:..
Zfish    20 HVFDLSINRFEALCQQRVVSTKRHLTCIEFNPVHPIIIVGNDRGRVI-----SLKLSPNLRKNPK 79

  Fly   732 EK 733
            |:
Zfish    80 EE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic61BNP_728477.1 WD40 358..730 CDD:225201 12/62 (19%)
WD40 repeat 381..429 CDD:293791
WD40 433..711 CDD:295369 9/43 (21%)
WD40 repeat 434..473 CDD:293791
WD40 repeat 552..599 CDD:293791
WD40 repeat 604..637 CDD:293791
WD40 repeat 645..682 CDD:293791 3/12 (25%)
WD40 repeat 691..727 CDD:293791 8/37 (22%)
dnai1.1XP_021324725.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006125
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.