DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic61B and Dnai2

DIOPT Version :9

Sequence 1:NP_728477.1 Gene:Dic61B / 38020 FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001030050.2 Gene:Dnai2 / 432611 MGIID:2685574 Length:623 Species:Mus musculus


Alignment Length:536 Identity:116/536 - (21%)
Similarity:204/536 - (38%) Gaps:116/536 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 GKIRRRSDNDAQTD---------TLLFTTR-AVNTILITKATVSSYVSNFEMYDTLNNITKEFAT 273
            ||....||..|:.:         ..|:..| .|:|.:...|::|.:.:|.|.:        |..:
Mouse    15 GKQCNFSDRQAELNIDILPNPELAALYVERNPVDTGIQCSASMSEHEANTERF--------EMES 71

  Fly   274 ATMSSVKDLTSALAQTEDADTFEDDEAVAEKDKVSSQIERLFRSPEFRNAIMYMGRTL-----SS 333
            ..::.|:.     ...:|.:..|.::.:..:.||.       :...:.||:|.:|..:     .:
Mouse    72 CGVNHVEG-----GWPKDVNPQELEQTIRFRKKVE-------KDENYINAVMQLGSIMEHCIKQN 124

  Fly   334 NTNEAGLRRFRNFDQVERWNAEAEYVYSMNLLFRLVPEPSKDERKAVSDIDFCRSNGDILAVAYG 398
            |..:.....|.:.:.|| ...||....::| :||   :|.:.:|.| :.:.:.......|||||.
Mouse   125 NAIDIYEEYFDDEEAVE-VTEEAPSAKTIN-VFR---DPQEIKRTA-THLSWHPDGNRKLAVAYS 183

  Fly   399 LYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSPFLPSLLAIGLYDGSVEVRDV-- 461
            ...|....:..:...::|.::||..||.|.....|:..:.::|....:|..|.|:|.:...|.  
Mouse   184 CLKFQRAPMSMNYDSYIWDLENPNRPEIALKPLSPLVTLEYNPKDSHVLLGGCYNGQIACWDTRK 248

  Fly   462 SSLQDTPVAVSQRSTSPGS--SPVVAIRWIKQVSDDDHETDIDPFLSLSQDGSVT--RFRIIKSP 522
            .||      |::.||...|  .||....|::.      :|..:.| |.|.||.|.  ..|.|..|
Mouse   249 GSL------VAELSTIEFSHRDPVYGTIWLQS------KTGTECF-SASTDGQVMWWDIRKISEP 300

  Fly   523 FLLGFTQMIL------ERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDIYYVLTDEGC 581
            .     ::::      |::|.....|.:...|.:|.:                   :.|.|::|.
Mouse   301 I-----EVVIMDISRKEQLENALGAISLEFESTLPTK-------------------FMVGTEQGI 341

  Fly   582 IHKCSINYQHQYLEVLRC----HDGGVTVMEFSPWSPKLFLTCGNDWFVRIWVDGITRPLLELLD 642
            :..|:...:.| .|.:.|    |.|.:..::.:|:.||.|||.| ||..|||.:.         .
Mouse   342 VISCNRKAKTQ-AEKIVCTFYGHHGPIYALQRNPFYPKNFLTVG-DWTARIWSED---------S 395

  Fly   643 EMTPVHWAK----------WSPTHSTIIVTVNRE-TANVWDFRRNLLRPMSKHKMDSSFNTVARF 696
            ..:.:.|.|          |||....:..|...: |.::||.......|....|:........|.
Mouse   396 RESSIMWTKYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLRV 460

  Fly   697 SHCGRTLVIGNERGNT 712
            ...|..:..|:|.|.|
Mouse   461 QDNGCLIACGSELGTT 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic61BNP_728477.1 WD40 358..730 CDD:225201 87/382 (23%)
WD40 repeat 381..429 CDD:293791 12/47 (26%)
WD40 433..711 CDD:295369 67/304 (22%)
WD40 repeat 434..473 CDD:293791 9/40 (23%)
WD40 repeat 552..599 CDD:293791 6/46 (13%)
WD40 repeat 604..637 CDD:293791 12/32 (38%)
WD40 repeat 645..682 CDD:293791 10/47 (21%)
WD40 repeat 691..727 CDD:293791 6/22 (27%)
Dnai2NP_001030050.2 WD40 repeat 165..212 CDD:293791 12/47 (26%)
WD40 <166..495 CDD:225201 81/359 (23%)
WD 1 214..254 10/45 (22%)
WD40 repeat 220..259 CDD:293791 11/44 (25%)
WD 2 261..302 14/52 (27%)
WD40 repeat 266..361 CDD:293791 24/126 (19%)
WD40 repeat 318..351 CDD:293791 7/51 (14%)
WD 3 362..401 14/48 (29%)
WD40 repeat 367..403 CDD:293791 12/45 (27%)
WD 4 405..445 7/39 (18%)
WD40 repeat 410..435 CDD:293791 5/24 (21%)
WD 5 450..489 6/27 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 565..602
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.