DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdk1 and wts

DIOPT Version :9

Sequence 1:NP_001261183.1 Gene:Pdk1 / 38017 FlyBaseID:FBgn0020386 Length:836 Species:Drosophila melanogaster
Sequence 2:NP_733403.1 Gene:wts / 43651 FlyBaseID:FBgn0011739 Length:1105 Species:Drosophila melanogaster


Alignment Length:519 Identity:133/519 - (25%)
Similarity:234/519 - (45%) Gaps:95/519 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NNNNSRYGSSKYLTNGHTSPLAAAVASNSSS-----------------VATTPHCRMLHNCS--- 180
            ||||.:..:|...|   |.|:..|..:|:||                 .:::..|:.:.:.|   
  Fly   566 NNNNIQISNSNLAT---TPPIPPAKYNNNSSNTGANSSGGSNGSTGTTASSSTSCKKIKHASPIP 627

  Fly   181 -----------------LQQYQND---IRQQTEILDMLRQQHQQGYQSQQQQQQ------PQQQQ 219
                             ::||...   ...:..|.::::...|:.|:..|.:::      |.|.|
  Fly   628 ERKKISKEKEEERKEFRIRQYSPQAFKFFMEQHIENVIKSYRQRTYRKNQLEKEMHKVGLPDQTQ 692

  Fly   220 EQQQQQEQSQQQQQLQNPAPRRSPNDFIFGRYIGEGSYSIVYLAVDIH-SRREYAIKVCEKRLIL 283
            .:.::....::...::....:...:.|:..:.||.|::..|.|...|. |...||:|...|..:|
  Fly   693 IEMRKMLNQKESNYIRLKRAKMDKSMFVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVL 757

  Fly   284 RERKQDYIKREREVMHQMTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTR 348
            :..:..::|.||:::.:..| ...|.|..:|||:.:|||||.|...||::..:.::|.|:....|
  Fly   758 KRNQVAHVKAERDILAEADN-NWVVKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELAR 821

  Fly   349 HYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALAT----EHCSE 409
            .|.||:..|.:.:|:...:|||:||:|||:|.|.|..:.|||           |.|    .|.|:
  Fly   822 FYIAEVTCAVDSVHKMGFIHRDIKPDNILIDRDGHIKLTDFG-----------LCTGFRWTHNSK 875

  Fly   410 QRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTA 474
            ..:.|.:...:||  :|..:|  |.      ::|......|     |.|.|.:.|....|.|||.
  Fly   876 YYQENGNHSRQDS--MEPWEE--YS------ENGPKPTVLE-----RRRMRDHQRVLAHSLVGTP 925

  Fly   475 QYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDF---PQG-FDK 535
            .|::||||:....|...|.|::|.|:|:|:.|.|||..::.....:::::.....   ||. ..:
  Fly   926 NYIAPEVLERSGYTQLCDYWSVGVILYEMLVGQPPFLANSPLETQQKVINWEKTLHIPPQAELSR 990

  Fly   536 DAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYLPGVSQDED 599
            :|.||:|:|. .....|||..     .:.:::|.||.|||:..:|:|..    ||:|.:....|
  Fly   991 EATDLIRRLC-ASADKRLGKS-----VDEVKSHDFFKGIDFADMRKQKA----PYIPEIKHPTD 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdk1NP_001261183.1 STKc_PDK1 244..571 CDD:270733 99/335 (30%)
S_TKc 246..571 CDD:214567 99/333 (30%)
PH_PDK1 658..764 CDD:241293
wtsNP_733403.1 STKc_LATS 717..1078 CDD:270749 110/365 (30%)
S_TKc 719..1020 CDD:214567 99/333 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.