DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdk1 and inaC

DIOPT Version :9

Sequence 1:NP_001261183.1 Gene:Pdk1 / 38017 FlyBaseID:FBgn0020386 Length:836 Species:Drosophila melanogaster
Sequence 2:NP_476863.1 Gene:inaC / 36897 FlyBaseID:FBgn0004784 Length:700 Species:Drosophila melanogaster


Alignment Length:641 Identity:137/641 - (21%)
Similarity:235/641 - (36%) Gaps:191/641 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TVASDCG-------------ENCSSNGTEHQQHFNIATTTATSATEATMPAM-------AKEKAS 91
            |...:||             |||:.| ..|             |.:.|:|.|       .:.|..
  Fly   148 TFCDECGLLLHGVAHQGVKCENCNLN-VHH-------------ACQETVPPMCGADISEVRGKLL 198

  Fly    92 ATVSLGESNFRDINLKDLAVVVEAASRLHHQQNVCGCGAVSSTENNNNSRYGSSKYLTNGHTSPL 156
            ..|.|..:|.: :::|:.|.::...                                |||.:.|.
  Fly   199 LYVELKGNNLK-VDIKEAANLIPMD--------------------------------TNGFSDPY 230

  Fly   157 AAAVASNSSSVATTPHCRMLH-----------NCSLQQYQNDIRQQTEILDMLRQQHQQ-----G 205
            .|.......|..|....:.:.           ...||....|.|...|:.|..|.....     .
  Fly   231 IAVQMHPDRSGRTKKKTKTIQKNLNPVFNETFTFELQPQDRDKRLLIEVWDWDRTSRNDFMGSFS 295

  Fly   206 YQSQQQQQQP--------------------------------QQQQEQQQQQEQSQQQQQLQNPA 238
            :..::.|::|                                :.:.:::..:::....:.:.:..
  Fly   296 FSLEELQKEPVDGWYKFLSQVEGEHYNIPCVDAFNDIARLRDEVRHDRRPNEKRRMDNKDMPHNM 360

  Fly   239 PRRS---PNDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQ 300
            .:|.   ..||.|.:.||:||:..|.||....:...||:||..|.:|::....:....|::::..
  Fly   361 SKRDMIRAADFNFVKVIGKGSFGKVLLAERRGTDELYAVKVLRKDVIIQTDDMELPMNEKKILAL 425

  Fly   301 MTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEHMHRRN 365
            ....|..|::...||....|:|||.|.:.||::.::.:.|.|..:....||.|:.:|...:|.|:
  Fly   426 SGRPPFLVSMHSCFQTMDRLFFVMEYCKGGDLMYHMQQYGRFKESVAIFYAVEVAIALFFLHERD 490

  Fly   366 VVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDEDSDRLENEDE 430
            :::||||.:|||||.:.|..:.|||.:|                                     
  Fly   491 IIYRDLKLDNILLDGEGHVKLVDFGLSK------------------------------------- 518

  Fly   431 DFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPEVLQNGPITPAADLWA 495
                       :|..|:|...                 :|.||..|::||::...|.:.|||.|:
  Fly   519 -----------EGVTERQTTR-----------------TFCGTPNYMAPEIVSYDPYSIAADWWS 555

  Fly   496 LGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDFPQGFDKDAEDLVRKLLRVDPRDRLGAQDEFG 560
            .|.::::.:||..||.|.::..:|:.|.|....||:.|..:|.|::...|...|.:||||    |
  Fly   556 FGVLLFEFMAGQAPFEGDDETTVFRNIKDKKAVFPKHFSVEAMDIITSFLTKKPNNRLGA----G 616

  Fly   561 YY--ESIRAHPFFAGIDWQTLRQ-QTPPPIYPYLPGVSQDEDFRSSYT-VPGDLEP 612
            .|  :.|..||||..:||..... :..|||.|.:.......:|..::| ...||.|
  Fly   617 RYARQEITTHPFFRNVDWDKAEACEMEPPIKPMIKHRKDISNFDDAFTKEKTDLTP 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdk1NP_001261183.1 STKc_PDK1 244..571 CDD:270733 89/328 (27%)
S_TKc 246..571 CDD:214567 88/326 (27%)
PH_PDK1 658..764 CDD:241293
inaCNP_476863.1 C1_1 72..124 CDD:278556
C1_1 137..189 CDD:278556 12/54 (22%)
C2_PKC_alpha_gamma 194..324 CDD:175992 22/162 (14%)
S_TKc 371..629 CDD:214567 88/326 (27%)
STKc_PKC 375..692 CDD:270722 99/367 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24356
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.