DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdk1 and W04B5.5

DIOPT Version :9

Sequence 1:NP_001261183.1 Gene:Pdk1 / 38017 FlyBaseID:FBgn0020386 Length:836 Species:Drosophila melanogaster
Sequence 2:NP_497551.1 Gene:W04B5.5 / 175360 WormBaseID:WBGene00021022 Length:320 Species:Caenorhabditis elegans


Alignment Length:380 Identity:123/380 - (32%)
Similarity:195/380 - (51%) Gaps:87/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 QQLQNP--APRRSPN-----DFIFGRYIGEGSYSIVYLAVDIHSRR---------EYAIKVCEKR 280
            :.|:||  |.|...|     |:...:.:||||:|.||||     ||         |.|:|:|.||
 Worm     5 ENLKNPQNARREGSNMKCLADYSVEKEVGEGSFSTVYLA-----RRKEPKNDENPEVALKICLKR 64

  Fly   281 LILRERKQDYIKREREVMHQMTNV----PGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRV-- 339
            |||:.:...||.||:|.:..::..    ||.|.|..||||..|||||:.||:.||:...:.:.  
 Worm    65 LILKNKMVPYIHREKEALALISREENAHPGIVTLYATFQDSESLYFVLEYAKYGDLCTLMQKQPD 129

  Fly   340 GSFDVACTRHYAAELLLACEHMHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALAT 404
            ..|:||.:|:|||.||.|.||:|:..::|||:|.:|:|:..|...::.||||:|.::        
 Worm   130 SKFNVADSRYYAANLLSALEHIHKLGIIHRDVKADNLLVKSDGRIMLTDFGSSKFLS-------- 186

  Fly   405 EHCSEQRRSNSDEDDEDSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKAS 469
                                           |.:::.:...|::|.             ..|::|
 Worm   187 -------------------------------DYQKIQENPVEEEQP-------------TGRRSS 207

  Fly   470 FVGTAQYVSPEVLQNGPITPAADLWALGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDFPQGF- 533
            |||||.:|:||:|....::|::||||....:|..:.|:.||...::|::|:.|.|....|.:.| 
 Worm   208 FVGTAFFVTPELLTGSEMSPSSDLWAFSVTLYLFLTGIYPFNDMSEYLVFRRIQDILYTFSEDFP 272

  Fly   534 DKDAEDLVRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIY 588
            |::|::|:.:||..:.:.||.:|:       |:.|.||..||::.|.|..||.||
 Worm   273 DENAKNLIERLLVKEQKSRLTSQE-------IKEHKFFESIDFEHLEQLEPPRIY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdk1NP_001261183.1 STKc_PDK1 244..571 CDD:270733 108/347 (31%)
S_TKc 246..571 CDD:214567 106/340 (31%)
PH_PDK1 658..764 CDD:241293
W04B5.5NP_497551.1 PKc_like 25..303 CDD:389743 107/341 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0592
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1157543at2759
OrthoFinder 1 1.000 - - FOG0001781
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101713
Panther 1 1.100 - - LDO PTHR24356
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2717
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.