DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsp1gamma and Fbp1

DIOPT Version :10

Sequence 1:NP_523868.1 Gene:Lsp1gamma / 38015 FlyBaseID:FBgn0002564 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_524065.1 Gene:Fbp1 / 39566 FlyBaseID:FBgn0000639 Length:1029 Species:Drosophila melanogaster


Alignment Length:93 Identity:22/93 - (23%)
Similarity:43/93 - (46%) Gaps:14/93 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LSLLSLLFSTNLTISESDH-IHMSTFCNQFSDNFTQTSTYETNRETVLSSLRLRSSLGSYSNATA 78
            :||.::..|:|..  |..| :|:::......:..||.|.::||.::.:.....|.|:..:...  
  Fly     1 MSLQNVSKSSNAL--EGIHGVHVTSHSPFSFEKTTQVSDFQTNTKSSVMESNQRLSIERFWQQ-- 61

  Fly    79 GISPDTVRGMFLC---RGD--ISETSCS 101
              .|..:|.  :|   |||  :.||:.:
  Fly    62 --RPPCLRP--ICCSIRGDQSVLETAAN 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsp1gammaNP_523868.1 Hemocyanin_N 31..153 CDD:461025 17/77 (22%)
Hemocyanin_M 159..490 CDD:459787
Hemocyanin_C 499..747 CDD:461026
Fbp1NP_524065.1 Hemocyanin_N 38..159 CDD:461025 12/54 (22%)
Hemocyanin_C 781..1025 CDD:461026
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.