DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsp1gamma and CG8100

DIOPT Version :10

Sequence 1:NP_523868.1 Gene:Lsp1gamma / 38015 FlyBaseID:FBgn0002564 Length:772 Species:Drosophila melanogaster
Sequence 2:NP_648693.2 Gene:CG8100 / 39565 FlyBaseID:FBgn0036410 Length:648 Species:Drosophila melanogaster


Alignment Length:86 Identity:25/86 - (29%)
Similarity:31/86 - (36%) Gaps:27/86 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SDSSFFSLVDERPYIIRYSLSYAPNLDRFPQTLSDKMDELIINATSSPSLSSTP--YFVEDQERV 195
            |.|.:...||.|||.  |.|...||                 .|:|..|.|..|  .|:.|..| 
  Fly    18 SFSIYMGTVDPRPYF--YLLQSQPN-----------------GASSPCSSSGKPLRVFMYDLPR- 62

  Fly   196 KQFEGSFDIDSMAQCSPDLDP 216
                 .|:|..|...|.|::|
  Fly    63 -----KFNIAMMDPHSSDVEP 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsp1gammaNP_523868.1 Hemocyanin_N 31..153 CDD:461025 8/19 (42%)
Hemocyanin_M 159..490 CDD:459787 14/60 (23%)
Hemocyanin_C 499..747 CDD:461026
CG8100NP_648693.2 Hemocyanin_N 41..163 CDD:461025 14/44 (32%)
Hemocyanin_C 446..>617 CDD:461026
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.