DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsp1gamma and LOC1281514

DIOPT Version :10

Sequence 1:NP_523868.1 Gene:Lsp1gamma / 38015 FlyBaseID:FBgn0002564 Length:772 Species:Drosophila melanogaster
Sequence 2:XP_321436.6 Gene:LOC1281514 / 1281514 VectorBaseID:AGAMI1_003332 Length:712 Species:Anopheles gambiae


Alignment Length:55 Identity:14/55 - (25%)
Similarity:22/55 - (40%) Gaps:15/55 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ERPYIIRYSLSYAPNLDRFPQTLSDKMDELIINATSSPSLSSTPYFVEDQERVKQ 197
            ::|.|:....|| .|||              :.|.||.:.|.....:.|..||::
Mosquito   582 QKPEILSQPASY-ENLD--------------VLAGSSTNASEVELELRDSRRVRE 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsp1gammaNP_523868.1 Hemocyanin_N 31..153 CDD:461025 2/9 (22%)
Hemocyanin_M 159..490 CDD:459787 8/39 (21%)
Hemocyanin_C 499..747 CDD:461026
LOC1281514XP_321436.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.