DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and CG15556

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster


Alignment Length:336 Identity:59/336 - (17%)
Similarity:110/336 - (32%) Gaps:136/336 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FVLGV---------REWTYAICLLIAI---LSMFIVLMVYLMCSEMRNSFYGVAIKAYA--ICMI 259
            |:|||         .|..:::.::..:   ||:..:||:::..:..: ||..:|.....  :|..
  Fly   441 FLLGVSKMQAGLDTNEDDHSLDVITNVGLTLSLLGLLMIFITAAVFK-SFRTLASTKILLNLCAA 504

  Fly   260 LGYALLAYLTLHNPANL------SNAACRILPSLALMNLVLSF---YILSFIAFKLYLSFYGV-- 313
            ||..||.:|.|.....|      .:..|.::.::....|::.|   :|:.|:.::.|:...||  
  Fly   505 LGLQLLFFLILSQSHLLEQLEQSESERCTLVGAVMQYLLLVVFSWMFIIGFLQYQRYVRVIGVNH 569

  Fly   314 -----------------VFTKLMFWL----------------------------IFTPIVLVAVG 333
                             :.|.|:.:|                            :..||.|:.|.
  Fly   570 PRHYILMSAVAAWTLPLIPTLLVVFLEPGSYRPNNSSMDYPILCYPSGYGLSLGVILPIGLITVA 634

  Fly   334 WSFFVGFSYYGSRLIFGGDTCWFDPRNWSVMIYFYAPVFVACAI---SGFFYVLSQIYIRDQPDI 395
            .:..||:.                  :|||    |..:|....|   .|.|.:|           
  Fly   635 NAILVGYI------------------SWSV----YTALFKRDLIFKQLGLFVLL----------- 666

  Fly   396 ETEKSFESIEKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWENRSHLNYAVSFCM--AFHGFAAL 458
                                |....:.|:..:|:: |::   .|.   :|..||:  ...||...
  Fly   667 --------------------FFLLGITWIFGLCTY-FDF---GRI---FAYLFCLTATLQGFVLF 704

  Fly   459 YALIGKNQQIQ 469
            ...|..|::.|
  Fly   705 LYFIVFNKENQ 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 47/282 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.