DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and CG11318

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_651842.3 Gene:CG11318 / 43678 FlyBaseID:FBgn0039818 Length:802 Species:Drosophila melanogaster


Alignment Length:317 Identity:61/317 - (19%)
Similarity:113/317 - (35%) Gaps:82/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 SHRGHIFSKHYCFTPLLHGNSTWEWQPLACAPEKLYFVLGVREWTYAICLLIAILSMFIVLMVYL 237
            |:|.:...:....||:               .||:..::.:...:.:   |:.||.:|:...:: 
  Fly   481 SYRANDLGEEILITPI---------------NEKVLDIISIVGCSLS---LLGILGIFLTAALF- 526

  Fly   238 MCSEMRNSFYGVAIKAYAICMILGYALLAYLTLHNPA-----NLSNAACRILPSLALMNLVLSF- 296
              ...|:......:....:.|.|...|..:|...:.:     |.:...|..|.:....::::.| 
  Fly   527 --KSWRSQASTKVLLHLCLAMCLQMMLFVFLNTDDVSEALVVNGNTVRCVALGAAMQYSILVLFS 589

  Fly   297 --YILSFIAFKLYLSFYG-------VVFTKLMFWLI-FTPIVLVAVGWSFFVGFSYYGSRLIFGG 351
              .|::|:.|:.|::..|       ::...::.||: ..|.:|||:    ....||..|......
  Fly   590 WMLIIAFLQFQRYVTVIGIERPPRYILKAAIVAWLLPLVPTLLVAL----IDPDSYVPSAAQLST 650

  Fly   352 DT--CWFDPRNWSVMIYFYAPV--FVACAISGFFYVLSQIYIRDQPDIETEKSFESIEKNRFKSF 412
            ||  |:  |..:.::.....||  ...|.:..|.||...|         :....:||.||..|..
  Fly   651 DTGICY--PSGYGLIFGVVLPVTLITVCNLVIFVYVFYSI---------SHSLSQSIHKNEKKMV 704

  Fly   413 WK-------YFGYTAVVWVVCICSF-----AFNYYWENRSHLNYAVSFCM--AFHGF 455
            .|       .|....:.|:..|.:|     ||:|.            ||:  ...||
  Fly   705 VKQIRLSIMLFFLLGLTWIFGIFAFMQAGVAFSYL------------FCITATMQGF 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 4/28 (14%)
CG11318NP_651842.3 GPS 437..475 CDD:280071
7tm_4 500..750 CDD:304433 55/283 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.