DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and mthl10

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_788446.2 Gene:mthl10 / 38057 FlyBaseID:FBgn0035132 Length:585 Species:Drosophila melanogaster


Alignment Length:534 Identity:130/534 - (24%)
Similarity:224/534 - (41%) Gaps:94/534 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FC---ILGVLLIL---------SGTHCSWGFHEETHY--------PCAFIDTANITGSYGL--DG 46
            :|   :||||.::         .||:.   ..|..||        ||.|.||.|:|| :.|  :|
  Fly    13 YCGVTLLGVLCLVVFRLIPGIPFGTYV---MAERDHYHTIDDPNVPCNFYDTVNLTG-HRLFPNG 73

  Fly    47 PFVHNWTVIPRHFVAVYDFVIENGI--RIPASRHLRACVCKTKPCVRICCLRGEIYDLEKRQCLV 109
            .:.:..|::|...|..||: |.:.:  ||....|:|.||||.|.|:.|||...::::.|...|::
  Fly    74 SYDYYGTIVPAELVGTYDY-IHSSLTERIEVREHVRGCVCKFKSCLNICCPWRQVFNSEVDGCII 137

  Fly   110 PVAGVSSLPSHSHMEVELGNGSLRLVKLQPRFSIHVETPCEHMKAV-TKGSEYVHWTLHENGT-- 171
            ..:...:.|....:.:...|.|..||.:..:|:|....||..|.:: .:.:.:..:.|.|||:  
  Fly   138 DHSDNRTWPDPPMLNITFRNESTILVNMFTQFAIQSFRPCPKMFSLQPETNNWDDYLLFENGSML 202

  Fly   172 -ISHRGHIFSKHYCFTPLLHGNST--WEWQPLACAPEKLYFVLGVREWTYAICLLIAILSMFIVL 233
             :..:..|....:|..|.....|.  :...|..|..:..:..:.:.. :||  ::.:|..|.:.:
  Fly   203 RVDDKLLIRKNEFCMVPTYVNESDMFYTIHPANCDMQDDHSTVKIIN-SYA--MMFSIPFMMLTI 264

  Fly   234 MVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYI 298
            .|||:..|:||. :|.::..|.|.:.:||:.|.|:.|:. .:.:...|::....|....:.::..
  Fly   265 AVYLLIPELRNQ-HGKSLVCYLIGLSVGYSSLCYVQLYQ-VDATGVTCKVFGYTAYFFFMGAYMW 327

  Fly   299 LSFIAFKLYLSFYGV------------VFTKLMFWLIFTPIVLVAVGWSFFVGFSYYGSRL---- 347
            ||.|:|.|:.:|.|.            :|..|..|    .|.||      |:.|:|...:|    
  Fly   328 LSVISFDLWHNFRGTRGINRFQEKKRFLFYSLYSW----GIALV------FLAFTYCAQQLTNLP 382

  Fly   348 ------IFGGDTCWFDPRNWSVMIYFYAPVFVACAISGFFYVLSQIYI--------------RDQ 392
                  |..|..||.|..||:.|||||.|:......:...::::.|.|              ...
  Fly   383 ANLKPGIGDGVYCWLDMSNWAAMIYFYGPILAIVVANTIMFIMTAIKIHGVQREMARIIASENST 447

  Fly   393 PDIETEKS---FESIEKNRFKSFWKYFGYTAVVWVVCICSF--AFNYYWENRSHLNYAVSFCMAF 452
            .::.|||.   :.:....||..|.:.|....:.|:..:.|:  ..:..|   |.|.|......|.
  Fly   448 KNLRTEKDKRFYRAWSNYRFGLFLRLFLIMGITWLTELISYFVGSDKGW---SKLFYISDLANAM 509

  Fly   453 HGFAALYALIGKNQ 466
            .||......:.|.:
  Fly   510 QGFLIFMLFVMKKK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 49/181 (27%)
mthl10NP_788446.2 Methuselah_N 56..236 CDD:284145 49/181 (27%)
7tm_4 244..514 CDD:304433 68/287 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.