DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and mthl3

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster


Alignment Length:500 Identity:112/500 - (22%)
Similarity:205/500 - (41%) Gaps:84/500 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CAFIDTANIT-------GSYGLDGPFVHNWTVIPRHFVAVYDF-VIENGIRIPASRHLRACVCKT 86
            |.|.||.:|:       |||..:|      .:||.|..|.||: ::.:..:...:.|:|.|.|..
  Fly    26 CDFFDTVDISKAPRFSNGSYLYEG------LLIPAHLTAEYDYKLLADDSKEKVASHVRGCACHL 84

  Fly    87 KPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHS-HMEVELGNGSLRLVKLQPRFSIHVETP-- 148
            :||:|.||  .:...::|.:|...:: ...|..|. .:.|.|.:||  :|:...:..:.|::.  
  Fly    85 RPCIRFCC--PQYQKMQKSKCYGDMS-EDELNKHDPFVNVTLSDGS--VVRRHFKEDLIVQSDLA 144

  Fly   149 ---CEHMKAVT---KGSEYVHWTLHENGTISH---RGHIFSKHYCFTPLLHGNSTWEWQPLACAP 204
               |..|..:.   .|:|:   ||.|||::..   :..:..:.||...|...:.:....|..|..
  Fly   145 KPGCPRMYFLNHELPGNEF---TLFENGSLLRHWDKVELSKREYCVQHLSFKDDSIRIAPHFCPL 206

  Fly   205 EKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLT 269
            ...:    .|.|. .:.::|:::.:.:.:.|||...::|| .:|.....|...:.|||..|..  
  Fly   207 SSEH----SRTWK-TVAIVISLICIILTISVYLYVEKLRN-LHGKCFICYLASLFLGYFFLVL-- 263

  Fly   270 LHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFWL-------IFTPI 327
              |....|:..|.....|...:::.:|:.||.|:..|:.||.|     ...||       .|...
  Fly   264 --NVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSG-----NSSWLNRFLPQNRFLSY 321

  Fly   328 VLVAVGWSFFV-GFSYYGSRLIFG---------GDTCWFDPRNWSVMIYFYAPVFVACAISGFFY 382
            .|.|.|.:..: ..:|...:::..         |..||....:.:||||||.|:.:....:...:
  Fly   322 NLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMF 386

  Fly   383 VLSQIYI-----RDQPDIETEKSFESI--EKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWENRS 440
            ||:...|     ..|...:.:|:...:  :|..:..|.:.|....:.|.:.|.||..:   :|::
  Fly   387 VLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLS---KNQA 448

  Fly   441 HLNYAVSFCMAFH-----GFAALYALIGKNQQIQNFLRRIDNGED 480
               :|.:|.:|.:     |.......:.:...::....||..|.|
  Fly   449 ---WAKAFMVADYFNWSQGTVIFLLFVLRPSTLKLLKERIKGGRD 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 47/191 (25%)
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 47/191 (25%)
7tm_4 216..436 CDD:304433 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.