DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and mthl4

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster


Alignment Length:454 Identity:104/454 - (22%)
Similarity:187/454 - (41%) Gaps:92/454 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CAFIDTANIT-------GSYGLDGPFVHNWTVIPRHFVAVYDF-VIENGIRIPASRHLRACVCKT 86
            |.|.||.:|:       |||..:|      .:||.|..|.||: ::.:..:...:.|:|.|.|..
  Fly    23 CDFFDTVDISKAPRFSNGSYLYEG------LLIPAHLTAEYDYKLLADDSKEKVASHVRGCACHL 81

  Fly    87 KPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHS-HMEVELGNGSLRLVKLQPRFSIHVETP-- 148
            :||:|.||  .:...::|.:|...:: ...|..|. .:.|.|.:||  :|:...:..:.|::.  
  Fly    82 RPCIRFCC--PQYQKMQKSKCYGDMS-EDELNKHDPFVNVTLSDGS--VVRRHFKEDLIVQSDLA 141

  Fly   149 ---CEHMKAVT---KGSEYVHWTLHENGTISH---RGHIFSKHYCFTPLLHGNSTWEWQPLACAP 204
               |..|..:.   .|:|:   ||.|||::..   :..:..:.||...|...:.:....|..|..
  Fly   142 KPGCPRMYFLNHELPGNEF---TLFENGSLLRHWDKVELSKREYCVQHLSFKDDSIRIAPHFCPL 203

  Fly   205 EKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLT 269
            ...:    .|.|. .:.::|:::.:.:.:.|||...::|| .:|.....|...:.|||..|..  
  Fly   204 SSEH----SRTWK-TVAIVISLICIILTISVYLYVEKLRN-LHGKCFICYLASLFLGYFFLVL-- 260

  Fly   270 LHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSF------------------YGVVFT 316
              |....|:..|.....|...:::.:|:.||.|...|.:.|                  |     
  Fly   261 --NVWKYSSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAY----- 318

  Fly   317 KLMFWLIFTPIVLVAVGWSFFVGFSYYGSRLIFG---------GDTCWFDPRNWSVMIYFYAPVF 372
            .|..|.|  |:::.|:        :|...:::..         |..||....:.:||||||.|:.
  Fly   319 NLYAWGI--PLIMTAI--------TYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPML 373

  Fly   373 VACAISGFFYVLSQIYIRD-----QPDIETEKSFESI-EKNRFKSFWKYFGYTAVVWVVCICSF 430
            :..|.:...:|||.|||.:     :..:..:::.:.| ::..|..|.:.|....:.|...|.||
  Fly   374 LLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSF 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 47/191 (25%)
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 47/191 (25%)
7tm_4 213..>385 CDD:304433 40/191 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.