DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and Pdfr

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001245501.1 Gene:Pdfr / 31234 FlyBaseID:FBgn0260753 Length:738 Species:Drosophila melanogaster


Alignment Length:421 Identity:70/421 - (16%)
Similarity:140/421 - (33%) Gaps:155/421 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 YVHWTLHENGTISHRGHIFSKHYCFTPLLHGNSTWEWQPLACAPEKLYFVL-------------- 211
            :|::||.:.|.           ||         .|.|..|.|.|.....||              
  Fly   204 FVNYTLPQTGL-----------YC---------NWTWDTLLCWPPTPAGVLARMNCPGGFHGVDT 248

  Fly   212 ---GVRE--------------------WT-YAIC------------------------------- 221
               .:|:                    || |..|                               
  Fly   249 RKFAIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLE 313

  Fly   222 ---LLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLTLH-------NPANL 276
               |.:::.::.:.|:::.....:||:...:. |...:.|:|  .::..|||:       |....
  Fly   314 IVGLCLSLFALIVSLLIFCTFRSLRNNRTKIH-KNLFVAMVL--QVIIRLTLYLDQFRRGNKEAA 375

  Fly   277 SNAACRIL---PSLALMNLVL---------------SFYILSFIAFKLYLSFYGVVFTKLMFWLI 323
            :|.:..::   |.|...:.||               ..|:.:.:...::...:.:.|...:.|.:
  Fly   376 TNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCV 440

  Fly   324 FTPIVLVAVGWSFFVGFSYYGSRLIFGGDTCWFDPRNWSVMIYFY---APVFVACAISGFFYVLS 385
              ||::..| |:... ..|..:.|   |:..|    |:::..|::   .| .:|..:..|.::::
  Fly   441 --PILMTTV-WARCT-VMYMDTSL---GECLW----NYNLTPYYWILEGP-RLAVILLNFCFLVN 493

  Fly   386 QIYIRDQPDIETEKSFESIEKNRFKS------FWKYFGYTAVVWVVCICSFAFNY-YWENRSHLN 443
            .|.:......:::.|  .||:.| |:      .....|.|.::..:.....|.|: .|      :
  Fly   494 IIRVLVMKLRQSQAS--DIEQTR-KAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVW------S 549

  Fly   444 YAVSFCMAFHGF--AALYALIGKNQQIQNFL 472
            |...|..:|.||  |.:|..:  |.:::..|
  Fly   550 YGTHFLTSFQGFFIALIYCFL--NGEVRAVL 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 9/40 (23%)
PdfrNP_001245501.1 HRM 213..272 CDD:280888 11/78 (14%)
7tm_4 306..563 CDD:304433 48/280 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.