DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and Adgrg3

DIOPT Version :10

Sequence 1:NP_611998.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_038954076.1 Gene:Adgrg3 / 291854 RGDID:1305674 Length:574 Species:Rattus norvegicus


Alignment Length:231 Identity:48/231 - (20%)
Similarity:83/231 - (35%) Gaps:78/231 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 TPLLHGNSTWEWQPLAC---APEKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFY 247
            |.|::..|..:..|.:|   |....||:|.|..|..        |..|   .:||:..::.|:::
  Rat   349 TFLINVGSGSQGPPASCWVRAAIFHYFLLCVFTWMG--------LEAF---HLYLLVIKVFNTYF 402

  Fly   248 GVAIKAYAICMILGYALLAYL-------------TLHNPAN-LSNAACRILPSLALMNLVLSFYI 298
            |   ..:....:||:.|...:             |:.:..| .|...|......||...|..:::
  Rat   403 G---HYFLKLSLLGWGLPVLIVIGVGSSNSYGVYTIRDQENRTSLELCWFQKEPALYATVHGYFL 464

  Fly   299 LSFIAFKLYLSFYGVVFTKLMFWLIFT--------------PIVLVAVGWSFFVGFSYYGSRLI- 348
            ::|:        :|.|...::.|.|||              ..||..:|.|..||.: :|..:: 
  Rat   465 VTFL--------FGAVVLAMVAWKIFTLPSVTAGKGQGQTWKSVLTVLGLSSLVGMT-WGLAVLT 520

  Fly   349 -FGGDT----------------CWFDPRNWSVMIYF 367
             .|..|                |||      :::||
  Rat   521 PLGLSTVYIFTLLNSLQGLFIFCWF------IILYF 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_611998.1 Methuselah_N 30..202 CDD:429053 4/15 (27%)
7tm_GPCRs 213..475 CDD:475119 39/201 (19%)
TM helix 1 214..238 CDD:410628 4/23 (17%)
TM helix 2 248..269 CDD:410628 4/33 (12%)
TM helix 5 360..383 CDD:410628 2/8 (25%)
TM helix 6 409..431 CDD:410628
TM helix 7 434..465 CDD:410628
Adgrg3XP_038954076.1 GPS 244..282 CDD:460350
7tm_GPCRs 292..551 CDD:475119 48/231 (21%)
TM helix 1 295..319 CDD:410628
TM helix 2 333..354 CDD:410628 2/4 (50%)
TM helix 3 366..388 CDD:410628 7/29 (24%)
TM helix 4 408..424 CDD:410628 3/15 (20%)
TM helix 5 454..475 CDD:410628 6/28 (21%)
TM helix 6 500..522 CDD:410628 7/22 (32%)
TM helix 7 524..549 CDD:410628 4/30 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.