DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and CG15744

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_572870.2 Gene:CG15744 / 2768909 FlyBaseID:FBgn0030466 Length:1797 Species:Drosophila melanogaster


Alignment Length:329 Identity:58/329 - (17%)
Similarity:106/329 - (32%) Gaps:99/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILGVLLILSGTHCSWGFHEETHYPCAFIDTANITGSYGLDGPFVHNWTVIPRHFVAVYDFVIENG 70
            |||:.|:      .||.   ....|......|:......|..|:|:.|.:....|.....||..|
  Fly   885 ILGIYLV------GWGI---ALLICGISSAVNLAEYATYDYCFLHSSTTLNALLVPAVILVIFCG 940

  Fly    71 IRIPASRHLRACVCKTKPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHSHMEVEL--GNGSLR 133
            |       |..|:........:..|:.::...:.||     ...::..:..|::::.  .|||..
  Fly   941 I-------LALCIYYQLSQQAVNVLQLQMQHQQNRQ-----YSDNNTQATEHIDLDWLDANGSAT 993

  Fly   134 LV------------KLQPRFSIHVETPCEHMKAVTKGSEYVHWTLHENGTISH-RGHIFSKHYCF 185
            ..            |.|........|....:.::...        .|...:|| ||     |:.|
  Fly   994 TAAIGGGSGNHGGRKEQDHMQEQYSTLSNPLSSIVDD--------FERSNLSHLRG-----HFIF 1045

  Fly   186 TPLLHGNSTWEWQPLAC---APEKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFY 247
            ..|..|    .|...|.   ..::||.:      ::|.|  .::|.:|:::...|..::.|.::.
  Fly  1046 LVLYAG----AWLSAAAYVNGGQELYVL------SFAGC--CSVLGIFLLIFYNLSRNDARQAWS 1098

  Fly   248 ----GVAIKAYAI---------------------CMILGYALLAYLTLHNPANL----------S 277
                |.:|.|..:                     ..::..:::||.....|.:|          |
  Fly  1099 QGRDGRSIPAKLVTYNNGSQARGAHPSSMMPGPGTAMISNSIVAYKANPGPGSLYEANNSAGSRS 1163

  Fly   278 NAAC 281
            |:.|
  Fly  1164 NSQC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 33/186 (18%)
CG15744NP_572870.2 LRR_8 107..168 CDD:290566
LRR_4 107..147 CDD:289563
leucine-rich repeat 109..133 CDD:275378
leucine-rich repeat 134..157 CDD:275378
LRRCT 166..216 CDD:214507
IG_like 229..344 CDD:214653
HRM <366..412 CDD:295297
7tm_4 768..>975 CDD:304433 22/110 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.