DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and mthl11

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_731479.3 Gene:mthl11 / 117467 FlyBaseID:FBgn0045443 Length:532 Species:Drosophila melanogaster


Alignment Length:554 Identity:132/554 - (23%)
Similarity:220/554 - (39%) Gaps:104/554 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QFCILGVLLILSGTHCSWGFHEETHYPCAFIDTANITGSYGL-DGPFVHNWTVIPRHFVAVYDFV 66
            ::.:||:|:|        |........|.|.||..:..|..| :|.:.:...|||......||:.
  Fly     7 EYLLLGILVI--------GVRSRDIPNCDFFDTVQLRESEKLCNGSYRYEDVVIPAKLTGKYDYE 63

  Fly    67 IE-NGIRIPASRHLRACVCKTKPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHSHMEVELGNG 130
            |: :|.|:...:|:|.||||.|.|:|.||...::  :....|...|  ..:|.....:::...||
  Fly    64 IDYDGDRVSVPKHIRGCVCKLKTCIRFCCHHKKL--MAGNLCSQDV--YENLTYEYTLDITQLNG 124

  Fly   131 SLRLVKLQPRFSIHVE----TPCE-HMKAVTKGSEYVHWTLHENGTISH---RGHIFSKHYCFTP 187
            |  ::|......:.|:    .||| |.....:.|.|..|:|:|||::..   :.::..:.:|..|
  Fly   125 S--VIKKHVLNDMVVQQDLPLPCERHYSLDAETSTYDMWSLYENGSLFRHFDQRYLSKQEFCLQP 187

  Fly   188 LLHGNSTWEWQPLACA-----PEKLYFVLGVREWTYAICLLIAILS-------------MFIVLM 234
              :..||.:...|..|     ...:....|..|     |:..:.||             |.|.:.
  Fly   188 --NPTSTGKNYSLIVAFNCIQKPSMKMAYGRFE-----CVRKSRLSNASIPVKFSSVFFMVITIA 245

  Fly   235 VYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLTLHNPANLSNAACRILPSLALMNLVLSFYIL 299
            .||...:.| |.:|.....|.||:.:.: ||..::|.....|....|.:........::.:|..|
  Fly   246 AYLWLPKFR-SLHGKCCNLYFICLAITF-LLNVISLFGIFELKTPICYLTGYAGYFTVMATFLWL 308

  Fly   300 SFIAFKLYLSF---YGVVFTKLMFWLIFTPIVLVAVGWS--------FFVGFSYYGSRL------ 347
            |.|:|.::..|   ...||.|......|...::|   ||        .|:...:..:.|      
  Fly   309 SVISFDVWRRFAMRKFQVFYKNKRSSFFNYNIIV---WSSAGLLTCIIFLVDQFVETNLDNPYNP 370

  Fly   348 IFGGDTCWFDPRNWSVMIYFYAP----VFVACAISGFFYVLSQIYIRDQPDIETEKSFESIEKNR 408
            ..|..:||.....||...|||||    :.:.||  .||.....||:.::.:.:...:.|..:.:|
  Fly   371 AVGVFSCWIFTNGWSATFYFYAPLAILIILNCA--SFFLTTRYIYVENKQNQKVLNNSEPQKLSR 433

  Fly   409 ----FKSFWKYFGYTAVVWVVCICSF--AFNYYWENRSHLN-----------YAVSFCMAFHGFA 456
                ::.:::.|......|.:.|.:|  .....|:....||           :..:||.  |   
  Fly   434 NHANYRIYFRLFIIMGGSWFLEIIAFICEMENMWKPLIILNDYINCSQGIIIFVATFCN--H--- 493

  Fly   457 ALYALIGKNQQIQNFLRRIDNGEDTCENSVPLSS 490
            .::.||.|  :|||  |.|.:.|.| ..|.|:.|
  Fly   494 EMFRLIRK--RIQN--RNITSLELT-NTSRPVES 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 50/181 (28%)
mthl11NP_731479.3 Methuselah_N 26..204 CDD:310923 51/185 (28%)
7tmB3_Methuselah-like 236..504 CDD:320167 61/281 (22%)
TM helix 2 258..280 CDD:320167 6/22 (27%)
TM helix 3 291..318 CDD:320167 5/26 (19%)
TM helix 4 335..355 CDD:320167 4/22 (18%)
TM helix 5 383..412 CDD:320167 11/30 (37%)
TM helix 6 433..460 CDD:320167 4/26 (15%)
TM helix 7 468..493 CDD:320167 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.