DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and LOC108182851

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_017210318.1 Gene:LOC108182851 / 108182851 -ID:- Length:93 Species:Danio rerio


Alignment Length:95 Identity:22/95 - (23%)
Similarity:33/95 - (34%) Gaps:36/95 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQFCILGVLLILSGTHCSW--GFHEETHYPCAFIDTANITGSYGL-----DGPFVHNWTVIPRH 58
            :|||.:||         |||  ||         |.:::.:.....|     .|.|:         
Zfish     5 LAQFVVLG---------CSWILGF---------FTNSSKVLEILFLILNSQQGTFI--------- 42

  Fly    59 FVAVYDFVIENGIRIPASRHLRACVCKTKP 88
             ..:| .|:..|||....:...:..|..||
Zfish    43 -FLIY-CVLNKGIRQEYRKLFTSLCCGLKP 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 12/64 (19%)
LOC108182851XP_017210318.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.