back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mthl8 and LOC108181087

DIOPT Version :9

Sequence 1:	NP_001261182.1	Gene:	mthl8 / 38013	FlyBaseID:	FBgn0052475	Length:	492	Species:	Drosophila melanogaster
Sequence 2:	XP_021329169.1	Gene:	LOC108181087 / 108181087	-ID:	-	Length:	166	Species:	Danio rerio

Alignment Length:	39	Identity:	10/39 - (25%)
Similarity:	15/39 - (38%)	Gaps:	15/39 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 IDTANITGSYGLDGPFVHNWTVIPRHFVAVYDFVIENGI 71
            |..|:.:|.|..||   |.|            ..::||:
Zfish    51 ITLASASGKYTADG---HCW------------LSVQNGV 74

Known Domains:

Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.