DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl8 and gpr157

DIOPT Version :9

Sequence 1:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster
Sequence 2:NP_001124512.1 Gene:gpr157 / 100038048 XenbaseID:XB-GENE-492646 Length:323 Species:Xenopus tropicalis


Alignment Length:219 Identity:43/219 - (19%)
Similarity:69/219 - (31%) Gaps:88/219 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 WQPLACAPEKLYFVLGVREWTYAICLLIAILSMF-------IVLMVYLMCSEMRNSFYGVAIKAY 254
            ||.|...|..|...|.|.:...|:.....:|..|       :........|...:.|:.||:..|
 Frog    40 WQDLRSRPRLLLLFLSVADLLSALSYFYGVLRNFQDSTWDCVTQGAISTFSNTSSFFWTVAVAVY 104

  Fly   255 AICMILGYALLAYLTLHNPANLSNAACRILPSLALMN----LVLSFYILSFIAFKL--YLSFYGV 313
                       .|:|:  ..:..:.|.:|:|.|.|::    ||::   ||.:..|.  |.:.|  
 Frog   105 -----------LYITI--VKSQQSFADQIIPWLHLISWGVPLVIT---LSAVCLKKIGYDASY-- 151

  Fly   314 VFTKLMFWLIFTPIVLVAVGWSFFVGFSYYGSRLIFGGDTCW--FDPRN-----------WSVMI 365
                            |:|||                   ||  .|..:           |.::.
 Frog   152 ----------------VSVGW-------------------CWVKIDVEDKLLWMLLAGKVWEILA 181

  Fly   366 YFYAPVFVACAISGFFYVLSQIYI 389
            |...||         .|:|.:.:|
 Frog   182 YLILPV---------LYILIKKHI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 3/4 (75%)
gpr157NP_001124512.1 7tm_GPCRs 17..>192 CDD:391938 41/213 (19%)
TM helix 1 17..39 CDD:341315
TM helix 2 48..69 CDD:341315 4/20 (20%)
TM helix 3 81..103 CDD:341315 4/21 (19%)
TM helix 4 123..139 CDD:341315 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.