Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_015338.1 | Gene: | CMR3 / 856123 | SGDID: | S000006217 | Length: | 317 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 204 | Identity: | 53/204 - (25%) |
---|---|---|---|
Similarity: | 83/204 - (40%) | Gaps: | 38/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 AQQSLPPQGTHLHSPPASPHSPLSTP--LGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEI 172
Fly 173 SMSVN-----DMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFG 232
Fly 233 YKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCS--HCDRQFVQVANLRR 295
Fly 296 HLRVHTGER 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 2/19 (11%) |
zf-H2C2_2 | 237..261 | CDD:290200 | 5/23 (22%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 264..289 | CDD:290200 | 11/26 (42%) | ||
C2H2 Zn finger | 280..300 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 6/13 (46%) | ||
C2H2 Zn finger | 308..328 | CDD:275368 | |||
zf-H2C2_2 | 321..345 | CDD:290200 | |||
C2H2 Zn finger | 336..352 | CDD:275368 | |||
CMR3 | NP_015338.1 | COG5048 | 17..316 | CDD:227381 | 53/204 (26%) |
C2H2 Zn finger | 256..276 | CDD:275370 | 9/19 (47%) | ||
C2H2 Zn finger | 284..306 | CDD:275370 | 7/21 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I1809 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |