DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CMR3

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:53/204 - (25%)
Similarity:83/204 - (40%) Gaps:38/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 AQQSLPPQGTHLHSPPASPHSPLSTP--LGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEI 172
            :||.:|    |..||..:..:||..|  :.:...||     ||...||...|.:.:.     |.|
Yeast   136 SQQPIP----HSQSPHLTSSAPLMMPVMVPTVYKPL-----TPYDKEPITIASEPNF-----TAI 186

  Fly   173 SMSVN-----DMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFG 232
            ||:.:     ::.|.....: ||..|..|.......|             |.||....:.:.|..
Yeast   187 SMASHPNAALELCHDRPKSV-PPGYGVLPTMQEASNG-------------RTKSEPGAVLNGSAT 237

  Fly   233 YKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCS--HCDRQFVQVANLRR 295
            :.. .:...|..:.:...:||.|.|..:|...||||..:|||:.|:.|:  .|.:.|...:|:.|
Yeast   238 FSD-WKTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLR 301

  Fly   296 HLRVHTGER 304
            ||:.|..:|
Yeast   302 HLKSHERKR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 2/19 (11%)
zf-H2C2_2 237..261 CDD:290200 5/23 (22%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 11/26 (42%)
C2H2 Zn finger 280..300 CDD:275368 7/21 (33%)
zf-H2C2_2 292..316 CDD:290200 6/13 (46%)
C2H2 Zn finger 308..328 CDD:275368
zf-H2C2_2 321..345 CDD:290200
C2H2 Zn finger 336..352 CDD:275368
CMR3NP_015338.1 COG5048 17..316 CDD:227381 53/204 (26%)
C2H2 Zn finger 256..276 CDD:275370 9/19 (47%)
C2H2 Zn finger 284..306 CDD:275370 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.