DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and AT3G29340

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_189580.1 Gene:AT3G29340 / 822592 AraportID:AT3G29340 Length:650 Species:Arabidopsis thaliana


Alignment Length:249 Identity:48/249 - (19%)
Similarity:69/249 - (27%) Gaps:105/249 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 EISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKH 235
            |:.:.:.:|...||...|...|               |.:.:..:.....|..||||.:||....
plant     7 ELLLDLREMVSQSGFEKSTTCS---------------GVIALRSNLQSKSSHKCKICGKSFECYQ 56

  Fly   236 VLQNHERTH---------------------------TGEKPFECPECHKRFTRDHHLKTHMRLHT 273
            .|..|:|.|                           :....:||..|.|.|.....|..|.:||.
plant    57 ALGGHQRIHRPIKEKLSKQEFSEVYPRKSKLQKRPESSSSCYECKVCGKIFGCYRGLGGHTKLHR 121

  Fly   274 G-----------------------------------EKPYHCSHCDRQFVQVANLRRHLRVHTGE 303
            .                                   ||..||....:.|.:..:       |:|.
plant   122 STKRELASTQDENSLLDSSEAKKIVSQPSSFKVSQEEKFLHCVELKQDFSEPLS-------HSGA 179

  Fly   304 RPYT----------------CEICDGKFSDSNQLKSHMLVH---NGEKPFECER 338
            .|.|                |:||...|..|..|.:|..||   :|:  ..|:|
plant   180 LPSTLRSKLQTKTQWKSSCHCKICGKSFVCSQGLGNHKRVHREISGK--LACKR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
zf-H2C2_2 237..261 CDD:290200 9/50 (18%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
zf-H2C2_2 264..289 CDD:290200 9/59 (15%)
C2H2 Zn finger 280..300 CDD:275368 2/19 (11%)
zf-H2C2_2 292..316 CDD:290200 7/39 (18%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..345 CDD:290200 7/21 (33%)
C2H2 Zn finger 336..352 CDD:275368 2/3 (67%)
AT3G29340NP_189580.1 zf-C2H2_6 43..68 CDD:290623 10/24 (42%)
C2H2 Zn finger 45..65 CDD:275368 9/19 (47%)
C2H2 Zn finger 100..120 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.