Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_189580.1 | Gene: | AT3G29340 / 822592 | AraportID: | AT3G29340 | Length: | 650 | Species: | Arabidopsis thaliana |
Alignment Length: | 249 | Identity: | 48/249 - (19%) |
---|---|---|---|
Similarity: | 69/249 - (27%) | Gaps: | 105/249 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 EISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKH 235
Fly 236 VLQNHERTH---------------------------TGEKPFECPECHKRFTRDHHLKTHMRLHT 273
Fly 274 G-----------------------------------EKPYHCSHCDRQFVQVANLRRHLRVHTGE 303
Fly 304 RPYT----------------CEICDGKFSDSNQLKSHMLVH---NGEKPFECER 338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 9/19 (47%) |
zf-H2C2_2 | 237..261 | CDD:290200 | 9/50 (18%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 264..289 | CDD:290200 | 9/59 (15%) | ||
C2H2 Zn finger | 280..300 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 7/39 (18%) | ||
C2H2 Zn finger | 308..328 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 321..345 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 336..352 | CDD:275368 | 2/3 (67%) | ||
AT3G29340 | NP_189580.1 | zf-C2H2_6 | 43..68 | CDD:290623 | 10/24 (42%) |
C2H2 Zn finger | 45..65 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 100..120 | CDD:275368 | 6/19 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |