DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and BCL6

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001124317.1 Gene:BCL6 / 604 HGNCID:1001 Length:706 Species:Homo sapiens


Alignment Length:369 Identity:118/369 - (31%)
Similarity:164/369 - (44%) Gaps:59/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDRSMSLSP---------PMSANTSATSA-AAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAA 82
            |:|...:||         |.|...|.:|. |.|..|.|...|.        |||...|.|.:...
Human   323 LNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASGSPPAK--------SPTDPKACNWKKYK 379

  Fly    83 FMAQLPMSTLANTLFPH-------NPAALFGAWAAQQSLPPQGTHLHSPPASPHS------PLST 134
            |:....::..|....|.       :|.|.....|.|..:.|:...|.||.....|      |.::
Human   380 FIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEPENLDLQSPTKLSASGEDSTIPQAS 444

  Fly   135 PLGS--GKHPLNSPNSTPQHHEP----AKKARKLSVKKEFQTEISMSVNDMYHTSGGPISPPSSG 193
            .|.:  .:....||.|:.:.|.|    ..|......:.....|:.:      ||: ||..|...|
Human   445 RLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCL------HTA-GPTFPEEMG 502

  Fly   194 SSPNSTHDGAGGNAG-----C-VGVSKDPS---------RDKSFTCKICSRSFGYKHVLQNHERT 243
            .:.:...|.:..|..     | ...|::.|         .||.:.|..|..||.||..|.:|:..
Human   503 ETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTV 567

  Fly   244 HTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTC 308
            ||||||:.|..|..:|.|..:||||.|:|:|||||.|..|..:|||||:||.|:.:||||:||.|
Human   568 HTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHTGEKPYPC 632

  Fly   309 EICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNH 352
            |||..:|.....||||:.:|.||||:.||:|::.||.:..|..|
Human   633 EICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLH 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
zf-H2C2_2 237..261 CDD:290200 11/23 (48%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 10/19 (53%)
zf-H2C2_2 292..316 CDD:290200 13/23 (57%)
C2H2 Zn finger 308..328 CDD:275368 9/19 (47%)
zf-H2C2_2 321..345 CDD:290200 13/23 (57%)
C2H2 Zn finger 336..352 CDD:275368 6/15 (40%)
BCL6NP_001124317.1 BTB 22..126 CDD:279045
BTB 33..126 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..349 7/25 (28%)
Required for interaction with NuRD complex and for transcriptional repressor activity 376..379 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..467 14/59 (24%)
C2H2 Zn finger 520..541 CDD:275368 3/20 (15%)
C2H2 Zn finger 548..568 CDD:275368 8/19 (42%)
zf-H2C2_2 560..585 CDD:290200 11/24 (46%)
C2H2 Zn finger 576..596 CDD:275368 9/19 (47%)
zf-H2C2_2 588..613 CDD:290200 14/24 (58%)
C2H2 Zn finger 604..624 CDD:275368 10/19 (53%)
zf-H2C2_2 616..641 CDD:290200 14/24 (58%)
C2H2 Zn finger 632..652 CDD:275368 9/19 (47%)
zf-H2C2_2 645..669 CDD:290200 13/23 (57%)
C2H2 Zn finger 660..678 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BISR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4623
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.