DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG14711

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650094.1 Gene:CG14711 / 41395 FlyBaseID:FBgn0037922 Length:377 Species:Drosophila melanogaster


Alignment Length:217 Identity:83/217 - (38%)
Similarity:107/217 - (49%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMYHTSGGPIS-----PP---SSGSSP--NSTH 200
            ||||...::|.::.||..|:|...|:.... .....:||.|.|     ||   |..|||  :|| 
  Fly   162 PNSTDSDYQPIERCRKAKVRKTRMTKRGRG-RPRGASSGHPRSFSEERPPVQASFKSSPEVSST- 224

  Fly   201 DGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHL 265
                                :..|:||...:..:..|..|.|.|..||||:|..|.|.|.....|
  Fly   225 --------------------NIMCEICGNIYSKRAALNIHMRRHMAEKPFKCEICSKSFAGPSEL 269

  Fly   266 KTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNG 330
            ..|:|:||||||:.|.:|:|.|...::..||.|.||.|||:||..|...||.||.||:|||.|.|
  Fly   270 NRHIRVHTGEKPFLCKYCNRSFADRSSNIRHERTHTNERPFTCSTCGKAFSYSNVLKNHMLTHTG 334

  Fly   331 EKPFECERCHMKFRRRHHLMNH 352
            ||||.|..|:..|.|:|.|..|
  Fly   335 EKPFLCRVCNKTFSRKHQLDQH 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
zf-H2C2_2 237..261 CDD:290200 12/23 (52%)
C2H2 Zn finger 252..272 CDD:275368 7/19 (37%)
zf-H2C2_2 264..289 CDD:290200 13/24 (54%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 11/23 (48%)
C2H2 Zn finger 308..328 CDD:275368 11/19 (58%)
zf-H2C2_2 321..345 CDD:290200 14/23 (61%)
C2H2 Zn finger 336..352 CDD:275368 6/15 (40%)
CG14711NP_650094.1 zf-AD 6..81 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
zf-H2C2_2 240..264 CDD:290200 11/23 (48%)
COG5048 249..>362 CDD:227381 54/108 (50%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-H2C2_2 268..292 CDD:290200 12/23 (52%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 299..321 CDD:290200 12/21 (57%)
C2H2 Zn finger 312..332 CDD:275368 11/19 (58%)
zf-H2C2_2 325..349 CDD:290200 14/23 (61%)
C2H2 Zn finger 340..362 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.