DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kr and CG31388

DIOPT Version :9

Sequence 1:	NP_001261181.1	Gene:	Kr / 38012	FlyBaseID:	FBgn0001325	Length:	502	Species:	Drosophila melanogaster
Sequence 2:	NP_650060.1	Gene:	CG31388 / 41355	FlyBaseID:	FBgn0051388	Length:	446	Species:	Drosophila melanogaster

Alignment Length:	132	Identity:	39/132 - (29%)
Similarity:	60/132 - (45%)	Gaps:	3/132 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   224 CKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSH-CDRQF 287
            |.||.:.......|:||...|.|.:..:|.:|...|.....|.:|.:.||.|:||.|.: |.:.|
  Fly   286 CHICGKHLTTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTF 350

  Fly   288 VQVANLRRHLRVH--TGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLM 350
            ...:....|.|||  ..:|.|.||.|...:...::.::|...||..:...||.|.:.|:...|..
  Fly   351 RFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFKTAKHYR 415

  Fly   351 NH 352
            :|
  Fly   416 SH 417

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kr	NP_001261181.1	C2H2 Zn finger	224..244	CDD:275368	6/19 (32%)
		zf-H2C2_2	237..261	CDD:290200	8/23 (35%)
		C2H2 Zn finger	252..272	CDD:275368	5/19 (26%)
		zf-H2C2_2	264..289	CDD:290200	10/25 (40%)
		C2H2 Zn finger	280..300	CDD:275368	5/20 (25%)
		zf-H2C2_2	292..316	CDD:290200	9/25 (36%)
		C2H2 Zn finger	308..328	CDD:275368	4/19 (21%)
		zf-H2C2_2	321..345	CDD:290200	7/23 (30%)
		C2H2 Zn finger	336..352	CDD:275368	5/15 (33%)
CG31388	NP_650060.1	zf-AD	4..76	CDD:285071
		C2H2 Zn finger	228..254	CDD:275368
		C2H2 Zn finger	286..306	CDD:275368	6/19 (32%)
		C2H2 Zn finger	314..334	CDD:275368	5/19 (26%)
		C2H2 Zn finger	342..363	CDD:275368	5/20 (25%)
		C2H2 Zn finger	373..393	CDD:275368	4/19 (21%)
		C2H2 Zn finger	401..419	CDD:275368	6/17 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100