DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG14655

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 / 40594 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster


Alignment Length:556 Identity:131/556 - (23%)
Similarity:204/556 - (36%) Gaps:164/556 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NTSATSAAAIYPAMG----LQQAAAASAFG----------------------MLSPTQLLA---- 75
            :||........|:.|    |||....:|.|                      :.|.|.|:|    
  Fly     3 STSVLCPLCAVPSFGSIDALQQRLIKAANGPLACPFANCKELFLGLDKLTIHLFSHTSLMAQEGN 67

  Fly    76 ---ANRQAAA---FMAQLPMSTLANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHSPL-- 132
               ||.|.|:   |:|..|         |...|....:.....:.||..|   :|||  |..:  
  Fly    68 ESPANGQPASSRGFLAAAP---------PKRRAKRTRSKPVVPTPPPVRT---TPPA--HCDICE 118

  Fly   133 ----STPLGSGKHPLNSPNS-------TPQHHEPAKKARKLSV-KKEFQTEISMSVN-DMYHTSG 184
                :|.|......|...|:       .||..||.::..|..: .|.|:.:.|:.:: .:.|..|
  Fly   119 FSFRNTELRDMHVRLVHENAEGEPKQKEPQQKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMG 183

  Fly   185 GPISPPSSGSSPNST---------------------HD-----GAGGNAGCVG------------ 211
            .|.|.|:...:|:.|                     |.     |.|.|:.|..            
  Fly   184 VPCSNPNPNPNPSPTPASTTSAVTATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSM 248

  Fly   212 VSKDPSRDKSFT-------CKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHM 269
            :.:.||..:|.|       |.:||:||..|:.|:.|:|.||||.|:.|..|.:.||.......|:
  Fly   249 LQQSPSSPESGTATPKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQSYHKHL 313

  Fly   270 RLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPF 334
            ..|:..||:.|..|.|.|.:::.|..|.|:|:||:|:.||:|...|........|..:|.|..|:
  Fly   314 LYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHTGVMPY 378

  Fly   335 ECERCHMKFRRRHHLMNHKCGIQSPPTP--ALSPAMSGD------YPVAISAIAIEASTNRFAAM 391
            :||.|...||.:.....|:|..:...||  .:...:.|:      .|.:....||.:|:      
  Fly   379 KCELCQKTFRYKVSQRTHRCPTEEAQTPEQLIKAFLEGNDSHTQPSPASAEIAAINSSS------ 437

  Fly   392 CATYGGSNESVDMEKATPEDDGPLDLSEDGASSVD----------GHCSNIARRKAQDIRRVFRL 446
                     .||     ||.:..|      :.|:|          |.|....|.:.|    :..|
  Fly   438 ---------IVD-----PEQEALL------SQSIDDIVVEQCQKLGICGVEPREEGQ----LISL 478

  Fly   447 PPPQIPHVPSDMPEQTEPEDLSMHSPRSIGSHEQTD 482
            .|..:.|...:.....:.::|.::||      :||:
  Fly   479 QPVAVVHFSGNGSPLQQLQNLRIYSP------QQTE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
zf-H2C2_2 237..261 CDD:290200 11/23 (48%)
C2H2 Zn finger 252..272 CDD:275368 5/19 (26%)
zf-H2C2_2 264..289 CDD:290200 8/24 (33%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 10/23 (43%)
C2H2 Zn finger 308..328 CDD:275368 5/19 (26%)
zf-H2C2_2 321..345 CDD:290200 8/23 (35%)
C2H2 Zn finger 336..352 CDD:275368 5/15 (33%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 10/22 (45%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
zf-H2C2_2 339..361 CDD:290200 10/21 (48%)
C2H2 Zn finger 352..372 CDD:275368 5/19 (26%)
zf-H2C2_2 364..389 CDD:290200 8/24 (33%)
C2H2 Zn finger 380..396 CDD:275368 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.