DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kr and CG10147

DIOPT Version :9

Sequence 1:	NP_001261181.1	Gene:	Kr / 38012	FlyBaseID:	FBgn0001325	Length:	502	Species:	Drosophila melanogaster
Sequence 2:	NP_001261477.1	Gene:	CG10147 / 38733	FlyBaseID:	FBgn0035702	Length:	448	Species:	Drosophila melanogaster

Alignment Length:	135	Identity:	45/135 - (33%)
Similarity:	68/135 - (50%)	Gaps:	3/135 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   222 FTCKI--CSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCD 284
            :.|::  ||..|.....|:.|...|.|.|.|.||.|..:.|..:.|:.|:..||.|:.:.|..|.
  Fly   292 YACELPECSMRFYSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCP 356

  Fly   285 RQFVQVANLRRHLR-VHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHH 348
            :......:|::|:| :|...|.|.|..|:.||:.::..|.|.:.|.|||.|||..|..||.:...
  Fly   357 KVCNSSTSLKKHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSA 421

  Fly   349 LMNHK 353
            |..|:
  Fly   422 LRTHR 426

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kr	NP_001261181.1	C2H2 Zn finger	224..244	CDD:275368	6/21 (29%)
		zf-H2C2_2	237..261	CDD:290200	9/23 (39%)
		C2H2 Zn finger	252..272	CDD:275368	6/19 (32%)
		zf-H2C2_2	264..289	CDD:290200	7/24 (29%)
		C2H2 Zn finger	280..300	CDD:275368	5/20 (25%)
		zf-H2C2_2	292..316	CDD:290200	9/24 (38%)
		C2H2 Zn finger	308..328	CDD:275368	6/19 (32%)
		zf-H2C2_2	321..345	CDD:290200	12/23 (52%)
		C2H2 Zn finger	336..352	CDD:275368	5/15 (33%)
CG10147	NP_001261477.1	zf-AD	7..80	CDD:214871
		C2H2 Zn finger	171..191	CDD:275368
		zf-C2H2_8	199..287	CDD:292531
		C2H2 Zn finger	199..221	CDD:275368
		C2H2 Zn finger	230..253	CDD:275368
		C2H2 Zn finger	264..284	CDD:275368
		C2H2 Zn finger	294..316	CDD:275368	6/21 (29%)
		C2H2 Zn finger	324..344	CDD:275368	6/19 (32%)
		C2H2 Zn finger	352..373	CDD:275368	5/20 (25%)
		C2H2 Zn finger	381..401	CDD:275368	6/19 (32%)
		C2H2 Zn finger	409..429	CDD:275368	6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100