DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG17568

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_609951.2 Gene:CG17568 / 35198 FlyBaseID:FBgn0032763 Length:513 Species:Drosophila melanogaster


Alignment Length:143 Identity:45/143 - (31%)
Similarity:62/143 - (43%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 KSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCD 284
            |.:.|..|.:.......|..|:..||..:||||..|...|.....||.|.::| .|..:.|:.|.
  Fly   339 KPYICDSCGKQLKTITALNEHKLVHTESRPFECTVCKAGFKNRARLKAHYQIH-AEPSFVCNICG 402

  Fly   285 RQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFR----- 344
            ::.........|..|||.||...|::|...|..|..||:|:|.|.|.:|:.|..|...|.     
  Fly   403 KKLQTRRTWNMHKVVHTEERRLKCDVCGALFKRSKTLKTHLLSHTGLRPYVCNYCGKSFACNANC 467

  Fly   345 RRHHLMNHKCGIQ 357
            |.|.|..|...:|
  Fly   468 RSHKLKKHPQEVQ 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 4/19 (21%)
zf-H2C2_2 237..261 CDD:290200 10/23 (43%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
zf-H2C2_2 264..289 CDD:290200 7/24 (29%)
C2H2 Zn finger 280..300 CDD:275368 3/19 (16%)
zf-H2C2_2 292..316 CDD:290200 8/23 (35%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 10/28 (36%)
C2H2 Zn finger 336..352 CDD:275368 6/20 (30%)
CG17568NP_609951.2 zf-AD 10..87 CDD:214871
COG5048 <313..471 CDD:227381 41/132 (31%)
C2H2 Zn finger 314..335 CDD:275368
C2H2 Zn finger 343..363 CDD:275368 4/19 (21%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..418 CDD:275368 3/19 (16%)
C2H2 Zn finger 426..446 CDD:275368 8/19 (42%)
zf-H2C2_2 439..463 CDD:290200 10/23 (43%)
C2H2 Zn finger 454..475 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.