DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG15436

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:197 Identity:66/197 - (33%)
Similarity:98/197 - (49%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KKEFQTEISMSVNDMYHTSGGP---------ISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDK 220
            |:.|:..:::..:...|.:..|         .:..|:..|...||.|                ::
  Fly   160 KRNFRLRVTLKAHMKTHNAAKPYECSHCAKTFAQQSTLQSHERTHTG----------------ER 208

  Fly   221 SFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDR 285
            .|.|..||::|.....|:.|.|||..|:||:|.:|.|.|||..||..|.|.||||:|:.||||.:
  Fly   209 PFKCSQCSKTFIKSSDLRRHIRTHGSERPFKCSKCTKTFTRKFHLDNHFRSHTGERPFKCSHCPK 273

  Fly   286 QFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLM 350
            .|....:|::|.|:|..:||:.|..|...|..|:.||.|.||||.|:.|:|..|...:::|..|.
  Fly   274 AFAMKQHLKQHSRLHLPDRPFRCSHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLA 338

  Fly   351 NH 352
            .|
  Fly   339 RH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 12/23 (52%)
C2H2 Zn finger 252..272 CDD:275368 10/19 (53%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 8/19 (42%)
zf-H2C2_2 292..316 CDD:290200 8/23 (35%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 11/23 (48%)
C2H2 Zn finger 336..352 CDD:275368 4/15 (27%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071
C2H2 Zn finger 128..148 CDD:275368
C2H2 Zn finger 156..176 CDD:275368 2/15 (13%)
COG5048 <180..341 CDD:227381 63/177 (36%)
C2H2 Zn finger 184..204 CDD:275368 2/19 (11%)
zf-H2C2_2 197..219 CDD:290200 8/37 (22%)
C2H2 Zn finger 212..232 CDD:275368 7/19 (37%)
zf-H2C2_2 224..249 CDD:290200 12/24 (50%)
C2H2 Zn finger 240..260 CDD:275368 10/19 (53%)
zf-H2C2_2 252..276 CDD:290200 13/23 (57%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..341 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.