Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 66/197 - (33%) |
---|---|---|---|
Similarity: | 98/197 - (49%) | Gaps: | 25/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 165 KKEFQTEISMSVNDMYHTSGGP---------ISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDK 220
Fly 221 SFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDR 285
Fly 286 QFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLM 350
Fly 351 NH 352 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 237..261 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 264..289 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 280..300 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 308..328 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 321..345 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 336..352 | CDD:275368 | 4/15 (27%) | ||
CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
C2H2 Zn finger | 128..148 | CDD:275368 | |||
C2H2 Zn finger | 156..176 | CDD:275368 | 2/15 (13%) | ||
COG5048 | <180..341 | CDD:227381 | 63/177 (36%) | ||
C2H2 Zn finger | 184..204 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 197..219 | CDD:290200 | 8/37 (22%) | ||
C2H2 Zn finger | 212..232 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 224..249 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 240..260 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 252..276 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 268..288 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 296..316 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 324..341 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |