DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Kr and CG8944

DIOPT Version :9

Sequence 1:	NP_001261181.1	Gene:	Kr / 38012	FlyBaseID:	FBgn0001325	Length:	502	Species:	Drosophila melanogaster
Sequence 2:	NP_573065.1	Gene:	CG8944 / 32517	FlyBaseID:	FBgn0030680	Length:	762	Species:	Drosophila melanogaster

Alignment Length:	132	Identity:	40/132 - (30%)
Similarity:	61/132 - (46%)	Gaps:	6/132 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   202 GAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKP--FEC--PECHKRFTRD 262
            |.||..|..|...|.:  |.:.|.:|.|||.....|..|...|..|:.  ::|  |:|:|.|...
  Fly   616 GGGGGGGSGGGGTDIA--KPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVAR 678

  Fly   263 HHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLV 327
            :.|..|::.|...:.:.|..|.:.|....||:.|.::|...:.|.|:||...|:.:..|..|...
  Fly   679 NSLFEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRR 743

  Fly   328 HN 329
            ||
  Fly   744 HN 745

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Kr	NP_001261181.1	C2H2 Zn finger	224..244	CDD:275368	7/19 (37%)
		zf-H2C2_2	237..261	CDD:290200	9/27 (33%)
		C2H2 Zn finger	252..272	CDD:275368	7/21 (33%)
		zf-H2C2_2	264..289	CDD:290200	6/24 (25%)
		C2H2 Zn finger	280..300	CDD:275368	6/19 (32%)
		zf-H2C2_2	292..316	CDD:290200	8/23 (35%)
		C2H2 Zn finger	308..328	CDD:275368	6/19 (32%)
		zf-H2C2_2	321..345	CDD:290200	4/9 (44%)
		C2H2 Zn finger	336..352	CDD:275368
CG8944	NP_573065.1	MADF_DNA_bdg	259..344	CDD:287510
		MADF	379..472	CDD:214738
		C2H2 Zn finger	476..496	CDD:275368
		C2H2 Zn finger	506..526	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
		C2H2 Zn finger	636..656	CDD:275368	7/19 (37%)
		zf-C2H2_8	639..712	CDD:292531	21/72 (29%)
		C2H2 Zn finger	666..688	CDD:275368	7/21 (33%)
		zf-C2H2	694..716	CDD:278523	6/21 (29%)
		C2H2 Zn finger	696..716	CDD:275368	6/19 (32%)
		zf-H2C2_2	708..733	CDD:290200	9/24 (38%)
		C2H2 Zn finger	724..744	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100