DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG9215

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_573045.1 Gene:CG9215 / 32494 FlyBaseID:FBgn0030659 Length:560 Species:Drosophila melanogaster


Alignment Length:434 Identity:112/434 - (25%)
Similarity:179/434 - (41%) Gaps:84/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MLQDAQTRTLAAALAGIKQEDVHLD-----RSMSLSPPMSANTSATSAAAIYPAMGLQQAAAASA 64
            ||.|.|...|...|   :|..|.|.     |.:::.|..|::.|.|...:..|:..:::....|.
  Fly   116 MLVDKQQEQLKLDL---EQAHVRLPATLKIRRLNVEPCSSSSVSGTITTSTEPSEDVKEEKTDSL 177

  Fly    65 FGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPHNPAALFGAWAAQQSLPP---QGT--HLH-- 122
            ..:.....:|:.|    .|.||..::..|....|..........|....|.|   :.|  ||:  
  Fly   178 SLIPDGAMVLSLN----DFQAQDSITQQAEEKDPKKQQDEDEGQAKMLELDPWDDENTPEHLYEI 238

  Fly   123 SPPASPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMYHTSGGPI 187
            ..|....|.:::|      ||..|   |.|  ||.:.:|.:.::                     
  Fly   239 ETPLIEESVVASP------PLPLP---PTH--PANQQKKRTYRR--------------------- 271

  Fly   188 SPPSSGSSPNSTHDGAGGN------AGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTG 246
                  .|||..|:....|      ||.....::..|.... |.:|..::.|:|.|..|.|.|..
  Fly   272 ------VSPNVKHEKLTANVDDDFKAGSTTKRRNCERSPKI-CDVCGNTYKYQHALNAHMRRHNN 329

  Fly   247 EKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEIC 311
            |:|:.|..|.|.|..:..|:.|||:|||:|||.|.||:|:|....:.::|.|:|||||||.||:|
  Fly   330 ERPYSCEVCQKAFISNVELRRHMRVHTGQKPYSCRHCERRFSDFGSSKKHERIHTGERPYVCEVC 394

  Fly   312 DGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNHKCGIQSPPTPALSPAMSGDYPVAI 376
            :..|:.::.|.:|...|.|:|.|:|.:|...|.::.:|..|....:.          ||:...::
  Fly   395 NKGFAYAHVLSAHRRTHTGKKQFQCTQCDKGFTKKTYLSAHMEQHRG----------SGNGEASV 449

  Fly   377 SAIAIEASTNRFAAMCATYGGSNESVDMEKATPEDDGPLDLSED 420
            ::.:.:||:.          ..|.|...|.|..:...|...|.|
  Fly   450 ASSSADASSR----------NQNASARKESARKQQQIPESFSLD 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 10/23 (43%)
C2H2 Zn finger 252..272 CDD:275368 8/19 (42%)
zf-H2C2_2 264..289 CDD:290200 15/24 (63%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
zf-H2C2_2 292..316 CDD:290200 12/23 (52%)
C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 321..345 CDD:290200 9/23 (39%)
C2H2 Zn finger 336..352 CDD:275368 4/15 (27%)
CG9215NP_573045.1 zf-AD 16..92 CDD:285071
DUF2117 165..>273 CDD:303038 26/149 (17%)
COG5048 <303..439 CDD:227381 53/136 (39%)
C2H2 Zn finger 307..327 CDD:275368 7/19 (37%)
zf-H2C2_2 319..344 CDD:290200 10/24 (42%)
zf-C2H2 333..355 CDD:278523 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
zf-H2C2_2 347..371 CDD:290200 14/23 (61%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-H2C2_2 375..400 CDD:290200 13/24 (54%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
zf-H2C2_2 404..427 CDD:290200 8/22 (36%)
C2H2 Zn finger 419..439 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.