DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and CG11695

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:193 Identity:53/193 - (27%)
Similarity:78/193 - (40%) Gaps:59/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 DPSRDKSFTCKICSRSFGYK-----HVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTG 274
            ||:   .|.|||||:....:     |:|:.|  .:..:..|.|.:|.|||::...|..|.|:|..
  Fly   262 DPN---YFRCKICSKQLVSRISYDVHMLRFH--PNKDDLSFACDQCSKRFSKQFLLTIHSRVHQQ 321

  Fly   275 EKPYHCSHCDRQFVQVANLRRHLRVHTGER---PYTCEICDGKF--------------------- 315
            |:...|.||||.|....:||.|:| .|.:.   |:.|:.|..||                     
  Fly   322 ERNEQCKHCDRSFRTAVDLRLHMR-RTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLP 385

  Fly   316 -----------SDSNQLKSHMLVH---NGEKPFECERCHMK----------FRRRHHLMNHKC 354
                       ||.|.|:.||.:|   ...:.::||:|.::          .|..|....|||
  Fly   386 EVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKC 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 8/24 (33%)
zf-H2C2_2 237..261 CDD:290200 8/23 (35%)
C2H2 Zn finger 252..272 CDD:275368 8/19 (42%)
zf-H2C2_2 264..289 CDD:290200 11/24 (46%)
C2H2 Zn finger 280..300 CDD:275368 10/19 (53%)
zf-H2C2_2 292..316 CDD:290200 10/58 (17%)
C2H2 Zn finger 308..328 CDD:275368 10/51 (20%)
zf-H2C2_2 321..345 CDD:290200 7/36 (19%)
C2H2 Zn finger 336..352 CDD:275368 5/25 (20%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 299..319 CDD:275368 8/19 (42%)
C2H2 Zn finger 327..348 CDD:275368 10/21 (48%)
C2H2 Zn finger 357..376 CDD:275368 4/18 (22%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 420..440 CDD:275368 4/19 (21%)
C2H2 Zn finger 448..468 CDD:275368 1/1 (100%)
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.