| Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_572451.1 | Gene: | CG10959 / 31743 | FlyBaseID: | FBgn0030010 | Length: | 443 | Species: | Drosophila melanogaster |
| Alignment Length: | 198 | Identity: | 60/198 - (30%) |
|---|---|---|---|
| Similarity: | 90/198 - (45%) | Gaps: | 29/198 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 222 FTCKICSRSFGYKHVLQNHERTHTGEKPFEC--PECHKRFTRDHHLKTHMRLHTGEKPYHCSHCD 284
Fly 285 RQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHL 349
Fly 350 MNHK-------------CGIQSPPTPALSPAMSGDYPVAISAIAIEASTNRFAAMCATYGGSNES 401
Fly 402 VDM 404 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 237..261 | CDD:290200 | 9/25 (36%) | ||
| C2H2 Zn finger | 252..272 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 264..289 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 280..300 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 292..316 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 308..328 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 321..345 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 336..352 | CDD:275368 | 5/15 (33%) | ||
| CG10959 | NP_572451.1 | C2H2 Zn finger | 232..253 | CDD:275368 | |
| COG5048 | <258..416 | CDD:227381 | 49/157 (31%) | ||
| C2H2 Zn finger | 258..278 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 289..308 | CDD:275368 | 7/18 (39%) | ||
| C2H2 Zn finger | 316..336 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 328..353 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 344..364 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 357..381 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 372..392 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 400..420 | CDD:275368 | 5/27 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I1809 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||