| Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_727050.1 | Gene: | CG12236 / 31523 | FlyBaseID: | FBgn0029822 | Length: | 553 | Species: | Drosophila melanogaster |
| Alignment Length: | 205 | Identity: | 48/205 - (23%) |
|---|---|---|---|
| Similarity: | 76/205 - (37%) | Gaps: | 39/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 145 SPNSTPQHHEPAKKARKLSV---------------KKEFQ-----TEISMSVNDMYHTSGGPISP 189
Fly 190 PSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFT-CKICSRSFGYKHVLQNHERT-HTGEKPFEC 252
Fly 253 PECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGE---RPYTCEICDGK 314
Fly 315 FSDSNQLKSH 324 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 5/20 (25%) |
| zf-H2C2_2 | 237..261 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 252..272 | CDD:275368 | 0/19 (0%) | ||
| zf-H2C2_2 | 264..289 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 280..300 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 292..316 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 308..328 | CDD:275368 | 6/17 (35%) | ||
| zf-H2C2_2 | 321..345 | CDD:290200 | 2/4 (50%) | ||
| C2H2 Zn finger | 336..352 | CDD:275368 | |||
| CG12236 | NP_727050.1 | BTB | 22..116 | CDD:279045 | |
| BTB | 33..116 | CDD:197585 | |||
| Herpes_capsid | <376..467 | CDD:283714 | 22/99 (22%) | ||
| C2H2 Zn finger | 483..512 | CDD:275371 | 10/28 (36%) | ||
| C2H2 Zn finger | 514..535 | CDD:275371 | 6/17 (35%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I1809 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||