DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and Bcl6

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001100554.1 Gene:Bcl6 / 303836 RGDID:1309345 Length:707 Species:Rattus norvegicus


Alignment Length:376 Identity:119/376 - (31%)
Similarity:165/376 - (43%) Gaps:73/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDRSMSLSP---------PMSANTSATSA-AAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAA 82
            |:|...:||         |.|...|::|. |.|..|.|...|.        |||...|.|.:...
  Rat   324 LNRKGLVSPQSPQKSDCQPNSPTESSSSKNACILQASGSPPAK--------SPTDPKACNWKKYK 380

  Fly    83 FMA--------------QLPMSTLANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHS--- 130
            |:.              |..:..|:...:|..|       |.|..:.|....|.||.....|   
  Rat   381 FIVLNSLNQNAKPEGSEQAELGRLSPRAYPAPP-------ACQPPMEPANLDLQSPTKLSASGED 438

  Fly   131 ---PLSTPLGS--GKHPLNSPNSTPQHHEP----AKKARKLSVKKEFQTEISMSVNDMYHTSGGP 186
               |.::.|.:  .:....||.|:.:.|.|    ..|......:....||:.:      ||: ||
  Rat   439 STIPQASRLNNIVNRSLAGSPRSSSESHSPLYMHPPKCTSCGSQSPQHTEMCL------HTA-GP 496

  Fly   187 ISPPSSGSSPNSTHDGAGGNAG-----C-VGVSKDPS---------RDKSFTCKICSRSFGYKHV 236
            ..|...|.:.:...|.:..|..     | ...|::.|         .||.:.|..|..||.||..
  Rat   497 TFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN 561

  Fly   237 LQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHT 301
            |.:|:..||||||:.|..|..:|.|..:||||.|:|:|||||.|..|..:|||||:||.|:.:||
  Rat   562 LASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAHVLIHT 626

  Fly   302 GERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNH 352
            ||:||.||||..:|.....||||:.:|.||||:.||:|::.||.:..|..|
  Rat   627 GEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHKSQLRLH 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 8/19 (42%)
zf-H2C2_2 237..261 CDD:290200 11/23 (48%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 10/19 (53%)
zf-H2C2_2 292..316 CDD:290200 13/23 (57%)
C2H2 Zn finger 308..328 CDD:275368 9/19 (47%)
zf-H2C2_2 321..345 CDD:290200 13/23 (57%)
C2H2 Zn finger 336..352 CDD:275368 6/15 (40%)
Bcl6NP_001100554.1 BTB_POZ_ZBTB27_BCL6 8..125 CDD:349640
PHA03247 <173..427 CDD:223021 26/117 (22%)
C2H2 Zn finger 521..542 CDD:275368 3/20 (15%)
C2H2 Zn finger 549..569 CDD:275368 8/19 (42%)
zf-H2C2_2 561..586 CDD:404364 11/24 (46%)
C2H2 Zn finger 577..597 CDD:275368 9/19 (47%)
zf-H2C2_2 589..614 CDD:404364 14/24 (58%)
C2H2 Zn finger 605..625 CDD:275368 10/19 (53%)
zf-H2C2_2 617..642 CDD:404364 14/24 (58%)
C2H2 Zn finger 633..653 CDD:275368 9/19 (47%)
zf-H2C2_2 646..670 CDD:404364 13/23 (57%)
C2H2 Zn finger 661..679 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BISR
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.