DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and Osr1

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_035989.1 Gene:Osr1 / 23967 MGIID:1344424 Length:266 Species:Mus musculus


Alignment Length:256 Identity:73/256 - (28%)
Similarity:99/256 - (38%) Gaps:65/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YPAMGLQQAAAASAFGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPH----NPAALFGAWAAQ 111
            ||||.|.:::.:...|.:|  .|:.|..|..||           ..|||    .|....|...|.
Mouse    59 YPAMHLPRSSFSKVPGAVS--SLMDARFQLPAF-----------PWFPHVIHPKPEITAGGSGAA 110

  Fly   112 QSLPPQGTHLH-SPPASPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISMS 175
            ....|:....: :..|:...|  |.||.|:.| .||            |..|....:. |::|  
Mouse   111 LKTKPRFDFANLALAATQEDP--TKLGRGEGP-GSP------------AGGLGALLDV-TKLS-- 157

  Fly   176 VNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNH 240
                      |...|:.|..|:.|                   .|.|.||.|.|.|...:.|..|
Mouse   158 ----------PEKKPTRGRLPSKT-------------------KKEFVCKFCGRHFTKSYNLLIH 193

  Fly   241 ERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHT 301
            |||||.|:|:.|..|||.|.|..||:.|..:|:.|||:.|..|.:.|.|...|..|..:|:
Mouse   194 ERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
zf-H2C2_2 237..261 CDD:290200 14/23 (61%)
C2H2 Zn finger 252..272 CDD:275368 9/19 (47%)
zf-H2C2_2 264..289 CDD:290200 10/24 (42%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 3/10 (30%)
C2H2 Zn finger 308..328 CDD:275368
zf-H2C2_2 321..345 CDD:290200
C2H2 Zn finger 336..352 CDD:275368
Osr1NP_035989.1 zf-C2H2 175..197 CDD:395048 10/21 (48%)
C2H2 Zn finger 177..197 CDD:275368 9/19 (47%)
zf-H2C2_2 189..214 CDD:404364 14/24 (58%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)
zf-H2C2_2 217..240 CDD:404364 9/22 (41%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.