DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and ZNF362

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001357141.1 Gene:ZNF362 / 149076 HGNCID:18079 Length:420 Species:Homo sapiens


Alignment Length:405 Identity:110/405 - (27%)
Similarity:164/405 - (40%) Gaps:104/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PPMSANTS---------ATSAAAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAAFMAQLPMST 91
            ||.||::.         |.|:.|:.....|||........:..|...|.| |.|.:.:..|.:||
Human    59 PPTSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHA-RPATSTVTGLGLST 122

  Fly    92 LANTLFPHNPAALFGAWAAQQSLPPQGTHLHSPPASPHSPL--STPL---GSGKHPLNSPNSTPQ 151
            ...::.....:|  ||.....:..|.     :|..:..|.|  |:|.   |....||.....|.|
Human   123 RTPSVSTSESSA--GAGTGTGTSTPS-----TPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQ 180

  Fly   152 HH---EPAKKARKLSVKKEFQTEISMSVNDMYHTSGGP---ISPPSSGSSPNSTHDGAGGNAGCV 210
            .|   .|.|..|.   :|:.:.|          ..|||   :.|....:|..:..:|        
Human   181 GHGLLGPPKSERG---RKKIKAE----------NPGGPPVLVVPYPILASGETAKEG-------- 224

  Fly   211 GVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGE 275
                     |::.||:|..:|..|..:|.|.::||..||.:||.|.|.|....:|..|:|:|.|.
Human   225 ---------KTYRCKVCPLTFFTKSEMQIHSKSHTEAKPHKCPHCSKSFANASYLAQHLRIHLGV 280

  Fly   276 KPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEI--CDGKFSDSNQLKSHMLVHNGEKPFECER 338
            ||||||:||:.|.|:::|::|.|:|||:|||.|..  |:..|:..:.|:||...||.:||::|..
Human   281 KPYHCSYCDKSFRQLSHLQQHTRIHTGDRPYKCPHPGCEKAFTQLSNLQSHQRQHNKDKPYKCPN 345

  Fly   339 CH---------------------------------------MKFRRRHHLMNHKCGIQSPPTPAL 364
            |:                                       ||...:|.::.|.....||.... 
Human   346 CYRAYSDSASLQIHLSAHAIKHAKAYCCSMCGRAYTSETYLMKHMSKHTVVEHLVSHHSPQRTE- 409

  Fly   365 SPAMSGDYPVAISAI 379
            ||.:    ||.||.|
Human   410 SPGI----PVRISLI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 11/23 (48%)
C2H2 Zn finger 252..272 CDD:275368 8/19 (42%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 9/19 (47%)
zf-H2C2_2 292..316 CDD:290200 11/25 (44%)
C2H2 Zn finger 308..328 CDD:275368 6/21 (29%)
zf-H2C2_2 321..345 CDD:290200 11/62 (18%)
C2H2 Zn finger 336..352 CDD:275368 5/54 (9%)
ZNF362NP_001357141.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PRK14971 <27..>125 CDD:237874 18/66 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..80 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 115..155 8/46 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..202 8/36 (22%)
C2H2 Zn finger 229..249 CDD:275368 7/19 (37%)
zf-H2C2_2 241..266 CDD:372612 11/24 (46%)
zf-C2H2 255..277 CDD:333835 8/21 (38%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
zf-H2C2_2 269..294 CDD:372612 14/24 (58%)
C2H2 Zn finger 285..305 CDD:275368 9/19 (47%)
SFP1 <307..359 CDD:227516 16/51 (31%)
C2H2 Zn finger 313..335 CDD:275368 6/21 (29%)
C2H2 Zn finger 343..363 CDD:275368 2/19 (11%)
C2H2 Zn finger 375..393 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.