DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kr and Bcl6b

DIOPT Version :9

Sequence 1:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_031554.1 Gene:Bcl6b / 12029 MGIID:1278332 Length:474 Species:Mus musculus


Alignment Length:362 Identity:109/362 - (30%)
Similarity:154/362 - (42%) Gaps:60/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TSAAAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPHNPAALFGAWA 109
            ||...:.||......|||:...|....|  |.:|...|....|.:|.....:.|..|..:....:
Mouse    98 TSRLRLSPATAPAVLAAATYLQMEHVVQ--ACHRFIQASYEPLGISLRPVEVEPPRPPTVAPPGS 160

  Fly   110 AQQSL----PP-------QGTHLHSP-PASP---------------HSPLS-------------- 133
            .::|.    ||       ||    || ||||               :|..|              
Mouse   161 PRRSEGHPDPPTESRSCSQG----SPSPASPDPKACNWKKYKFIVLNSQTSQAGSLVGESSGQPC 221

  Fly   134 --TPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISMSVNDMY------HTSGGPIS-- 188
              ..|.||....:|.:|:.:...|..::|........:.:.....|:.|      ..:..|.|  
Mouse   222 PQARLPSGDEACSSSSSSEEGTTPGLQSRLSLATTTARFKCGALANNSYLFTPRAQETSLPASKQ 286

  Fly   189 ---PPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPF 250
               ||.|........:...|.:..:.:......||.:.|::|..:|.||..|.:|...||||||:
Mouse   287 ANPPPGSEFFSCQNCEAVAGCSSGLELLAPGDEDKPYKCQLCRSAFRYKGNLASHRTVHTGEKPY 351

  Fly   251 ECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKF 315
            .|..|..||.|..:||||.|:|:|||||.|..|..:|||||:||.|:.:||||:||.|..|..:|
Mouse   352 RCSICGARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRF 416

  Fly   316 SDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHLMNH 352
            .....||||:.:|.||||:.|:.|.:.||.:..|..|
Mouse   417 RHLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLH 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 12/23 (52%)
C2H2 Zn finger 252..272 CDD:275368 10/19 (53%)
zf-H2C2_2 264..289 CDD:290200 14/24 (58%)
C2H2 Zn finger 280..300 CDD:275368 10/19 (53%)
zf-H2C2_2 292..316 CDD:290200 11/23 (48%)
C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..345 CDD:290200 12/23 (52%)
C2H2 Zn finger 336..352 CDD:275368 5/15 (33%)
Bcl6bNP_031554.1 BTB 28..132 CDD:279045 11/35 (31%)
BTB 39..131 CDD:197585 11/34 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..190 13/49 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..249 6/38 (16%)
C2H2 Zn finger 325..345 CDD:275368 7/19 (37%)
zf-H2C2_2 337..362 CDD:290200 12/24 (50%)
C2H2 Zn finger 353..373 CDD:275368 10/19 (53%)
zf-H2C2_2 365..390 CDD:290200 14/24 (58%)
C2H2 Zn finger 381..401 CDD:275368 10/19 (53%)
zf-H2C2_2 393..418 CDD:290200 12/24 (50%)
C2H2 Zn finger 409..429 CDD:275368 7/19 (37%)
zf-H2C2_2 422..446 CDD:290200 12/23 (52%)
C2H2 Zn finger 437..455 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4029
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4623
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.980

Return to query results.
Submit another query.