Sequence 1: | NP_001261181.1 | Gene: | Kr / 38012 | FlyBaseID: | FBgn0001325 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001116278.1 | Gene: | bcl6 / 100126063 | XenbaseID: | XB-GENE-984479 | Length: | 702 | Species: | Xenopus tropicalis |
Alignment Length: | 284 | Identity: | 99/284 - (34%) |
---|---|---|---|
Similarity: | 131/284 - (46%) | Gaps: | 72/284 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 127 SPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQTEISM-----SVNDMYHTS--G 184
Fly 185 GPISPPSSGSSPNSTHDG-----------------AGGNAG--------------CVG------- 211
Fly 212 ----VSKDPS---------RDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDH 263
Fly 264 HLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVH 328
Fly 329 NGEKPFECERCHMKFRRRHHLMNH 352 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kr | NP_001261181.1 | C2H2 Zn finger | 224..244 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 237..261 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 252..272 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 264..289 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 280..300 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 292..316 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 308..328 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 321..345 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 336..352 | CDD:275368 | 6/15 (40%) | ||
bcl6 | NP_001116278.1 | BTB | 24..128 | CDD:279045 | |
BTB | 35..131 | CDD:197585 | |||
C2H2 Zn finger | 515..536 | CDD:275368 | 2/20 (10%) | ||
C2H2 Zn finger | 543..563 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 555..580 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 583..608 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 599..619 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 611..636 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 627..647 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 640..664 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 655..673 | CDD:275368 | 7/17 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4623 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |