DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lov and lolal

DIOPT Version :10

Sequence 1:NP_611994.3 Gene:lov / 38007 FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster
Sequence 2:NP_524778.1 Gene:lolal / 44703 FlyBaseID:FBgn0022238 Length:127 Species:Drosophila melanogaster


Alignment Length:112 Identity:49/112 - (43%)
Similarity:77/112 - (68%) Gaps:0/112 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 YSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPVI 179
            :.|:||:.|.:::.:|..|...|:..||||.|...:.:|||||||||||:|:.:..|.|.|||:|
  Fly     8 FFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEENPSKHPII 72

  Fly   180 VLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVES 226
            :|||.....:|||::|||.||::|.|::|...::..:.|:|:||.|:
  Fly    73 ILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAET 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lovNP_611994.3 BTB_POZ_BAB-like 139..222 CDD:349624 39/82 (48%)
HTH_psq 791..834 CDD:283007
lolalNP_524778.1 BTB_POZ_BAB-like 32..115 CDD:349624 39/82 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.