DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lov and LOC3290595

DIOPT Version :10

Sequence 1:NP_611994.3 Gene:lov / 38007 FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster
Sequence 2:XP_061504414.1 Gene:LOC3290595 / 3290595 VectorBaseID:AGAMI1_013978 Length:232 Species:Anopheles gambiae


Alignment Length:103 Identity:43/103 - (41%)
Similarity:64/103 - (62%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 QNHILRA-FDALLK----TKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCKHPVIVLK 182
            ||...|| |.|.|.    .:.|||||:.|....:||||:||...||||:.:|.|.|..|||:::.
Mosquito    13 QNTERRASFPAALHAARLAELLVDVTICCESRKLRAHKLVLVLGSPFFRSIFNEVPTPHPVVMIY 77

  Fly   183 DFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQV 220
            :.:...:.|:|.|:|.||:||.::||.:|::|...||:
Mosquito    78 NVKYEDLDALVKFLYTGELSVERERLPSLLEAARYLQL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lovNP_611994.3 BTB_POZ_BAB-like 139..222 CDD:349624 36/82 (44%)
HTH_psq 791..834 CDD:283007
LOC3290595XP_061504414.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.