DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lov and ZBTB12

DIOPT Version :9

Sequence 1:NP_611994.3 Gene:lov / 38007 FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster
Sequence 2:NP_862825.1 Gene:ZBTB12 / 221527 HGNCID:19066 Length:459 Species:Homo sapiens


Alignment Length:314 Identity:62/314 - (19%)
Similarity:98/314 - (31%) Gaps:127/314 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 HQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPCK-------HPVI 179
            |:...||..:.|...:...|||:|......|.||::|:|||||.:..|...|..       |...
Human    15 HEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRDQFLLNPSSELQVSLMHSAR 79

  Fly   180 VLKD-----FRG---WVVQAIVDFMYRGE-------ISVPQQRLQTLIQAGESLQVRGLVESSV- 228
            ::.|     :.|   :.|:.||:::....       :...:..|...|:....|:..|:.|:|: 
Human    80 IVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCRNALSQFIEPKIGLKEDGVSEASLV 144

  Fly   229 -----------PEHTPTPAASPD---------------DFGMLDTSMLSSTFEDE---------C 258
                       |..||.||..|.               :|.:.:...|.:..|||         |
Human   145 SSISATKSLLPPARTPKPAPKPPPPPPLPPPLLRPVKLEFPLDEDLELKAEEEDEDEDEDVSDIC 209

  Fly   259 -------------------------------------------PTMVRPSKG------------- 267
                                                       |:.|.|.:|             
Human   210 IVKVESALEVAHRLKPPGGLGGGLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAE 274

  Fly   268 --GKLLMPSARLFGNASSAI---AALGLRRKREQESDRDLESDQELGGS-SPMP 315
              |.||:|..|....|:|.:   ||:.:       :.|........||| .|:|
Human   275 GEGLLLIPGGRASVGATSGLVEAAAVAM-------AARGAGGSLGAGGSRGPLP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lovNP_611994.3 BTB 130..225 CDD:279045 26/116 (22%)
BTB 141..226 CDD:197585 25/106 (24%)
HTH_psq 791..834 CDD:283007
ZBTB12NP_862825.1 BTB 23..127 CDD:306997 23/103 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..179 6/25 (24%)
C2H2 Zn finger 335..355 CDD:275368
zf-C2H2 359..381 CDD:306579
COG5048 <361..>448 CDD:227381
C2H2 Zn finger 361..381 CDD:275368
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 417..435 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.