DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lov and lolal

DIOPT Version :10

Sequence 1:NP_611994.3 Gene:lov / 38007 FlyBaseID:FBgn0266129 Length:1143 Species:Drosophila melanogaster
Sequence 2:XP_061510468.1 Gene:lolal / 1270680 VectorBaseID:AGAMI1_004509 Length:126 Species:Anopheles gambiae


Alignment Length:125 Identity:56/125 - (44%)
Similarity:82/125 - (65%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 APQDHYSLRWNNHQNHILRAFDALLKTKTLVDVTLVCAETSIRAHKMVLSACSPFFQRVFAETPC 174
            |.|..|.|:||:.|.:::.:|..|...|:..||||.|...:.:|||||||||||:|:.:..|.|.
Mosquito     2 ADQQQYFLKWNDFQTNMVTSFRHLRNEKSFTDVTLACEGQTCKAHKMVLSACSPYFKSLLEENPS 66

  Fly   175 KHPVIVLKDFRGWVVQAIVDFMYRGEISVPQQRLQTLIQAGESLQVRGLVESSVPEHTPT 234
            |||:|:|||.....:|||::|||.||::|.|::|.|.::..:.|:|:||.|      |||
Mosquito    67 KHPIIILKDVSYNHLQAILEFMYAGEVNVSQEQLPTFLKTADRLKVKGLAE------TPT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lovNP_611994.3 BTB_POZ_BAB-like 139..222 CDD:349624 40/82 (49%)
HTH_psq 791..834 CDD:283007
lolalXP_061510468.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.