DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gol and PJA2

DIOPT Version :9

Sequence 1:NP_001163300.1 Gene:gol / 38006 FlyBaseID:FBgn0004919 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_055634.3 Gene:PJA2 / 9867 HGNCID:17481 Length:708 Species:Homo sapiens


Alignment Length:196 Identity:51/196 - (26%)
Similarity:77/196 - (39%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 NIGQDLSLT--LDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSISFIVLMIISLVWLIFYYIQR 260
            |:..|.|::  ||..:::.....:|......||        :|...|:..|.:           .
Human   535 NLEDDSSVSEDLDVDWSLFDGFADGLGVAEAIS--------YVDPQFLTYMAL-----------E 580

  Fly   261 FRYMQAKDQQSRNLCSV-----------TKKAIMKIPTKTGKFSDEKDLDSD-CCAICIEAYKPT 313
            .|..||.:....:|.|:           :|::|..:| :|....|...:..: ||.||...|...
Human   581 ERLAQAMETALAHLESLAVDVEVANPPASKESIDGLP-ETLVLEDHTAIGQEQCCPICCSEYIKD 644

  Fly   314 DTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEESILEYQPD-PPQGLALVE 377
            |....|||.|.|||.|:..||.:..|||:|:   ..|...|...|.....|..|| ||...::.|
Human   645 DIATELPCHHFFHKPCVSIWLQKSGTCPVCR---RHFPPAVIEASAAPSSEPDPDAPPSNDSIAE 706

  Fly   378 A 378
            |
Human   707 A 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
golNP_001163300.1 PA_GRAIL_like 73..217 CDD:239037 5/20 (25%)
UPF0233 226..>258 CDD:299753 5/31 (16%)
zf-RING_2 301..344 CDD:290367 19/43 (44%)
PJA2NP_055634.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..495
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000269|PubMed:21423175 531..708 51/196 (26%)
zf-RING_2 634..675 CDD:290367 18/40 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..708 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.