powered by:
Protein Alignment gol and DZIP3
DIOPT Version :9
Sequence 1: | NP_001163300.1 |
Gene: | gol / 38006 |
FlyBaseID: | FBgn0004919 |
Length: | 601 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_055463.1 |
Gene: | DZIP3 / 9666 |
HGNCID: | 30938 |
Length: | 1208 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 27/63 - (42%) |
Similarity: | 40/63 - (63%) |
Gaps: | 4/63 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 DEKDLDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVL---KFYGY 353
||::.:.:.|.||.|...| :.:.:|||.|:||..||.|||::..|||.|:|.|| :|.|:
Human 1139 DEEEEEEEPCVICHENLSP-ENLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGH 1200
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.